We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DDX23 Recombinant Protein Antigen

Images

 
There are currently no images for DDX23 Recombinant Protein Antigen (NBP2-58799PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DDX23 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to DDX23.

Source: E. coli

Amino Acid Sequence: REEKDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFYGDLM

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DDX23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58799.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DDX23 Recombinant Protein Antigen

  • 100 kDa U5 snRNP-specific protein
  • DEAD (Asp-Glu-Ala-Asp) box polypeptide 23
  • DEAD box protein 23
  • EC 3.6.1
  • EC 3.6.4.13
  • MGC8416
  • probable ATP-dependent RNA helicase DDX23
  • PRP28 homolog
  • PRP28 homolog, yeast
  • prp28
  • PRP28p homolog
  • PRPF28
  • U5 snRNP 100 kD protein
  • U5-100K
  • U5-100kD

Background

DDX23 encodes a member of the DEAD box protein family. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure, such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. The protein encoded by this gene is a component of the U5 snRNP complex; it may facilitate conformational changes in the spliceosome during nuclear pre-mRNA splicing. An alternatively spliced transcript variant has been found for this gene, but its biological validity has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90086
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-13920
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-87194
Species: Hu
Applications: WB
NB100-40849
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, KD, WB
H00051428-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
NBP3-16440
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-13923
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-2076
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-31603
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16866
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-85269
Species: Hu, Mu, Rt
Applications: ICC/IF,  IHC-P, WB
NBP2-47274
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87049
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00006732-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP1-89343
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-16479
Species: Hu, Mu, Rt
Applications: ELISA, WB
NBP3-16119
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00010714-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
NB200-351
Species: Ha, Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-58799PEP
Species: Hu
Applications: AC

Publications for DDX23 Recombinant Protein Antigen (NBP2-58799PEP) (0)

There are no publications for DDX23 Recombinant Protein Antigen (NBP2-58799PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDX23 Recombinant Protein Antigen (NBP2-58799PEP) (0)

There are no reviews for DDX23 Recombinant Protein Antigen (NBP2-58799PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DDX23 Recombinant Protein Antigen (NBP2-58799PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDX23 Products

Research Areas for DDX23 Recombinant Protein Antigen (NBP2-58799PEP)

Find related products by research area.

Blogs on DDX23

There are no specific blogs for DDX23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDX5 Antibody
NB200-351

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DDX23 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DDX23