Recombinant Human DDIT4L GST (N-Term) Protein

12.5% SDS-PAGE Stained with Coomassie Blue.

Product Discontinued

Recombinant Human DDIT4L GST (N-Term) Protein Summary

• Description: A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-193 of Human DDIT4L
  
  

  Source: Wheat Germ (in vitro)

  Amino Acid Sequence: MVATGSLSSKNPASISELLDCGYHPESLLSDFDYWDYVVPEPNLNEVIFEESTCQNLVKMLENCLSKSKQTKLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS

• Preparation Method: in vitro wheat germ expression system
• Details of Functionality: This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
• Source: Wheat germ
• Protein/Peptide Type: Recombinant Protein
• Gene: DDIT4L
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
• Theoretical MW: 48.1 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -80C. Avoid freeze-thaw cycles.
• Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DDIT4L GST (N-Term) Protein

• DNA damage-inducible transcript 4-like protein
• DNA-damage-inducible transcript 4-like
• HIF-1 responsive protein RTP801-like
• homolog of mouse SMHS1
• Protein regulated in development and DNA damage response 2
• REDD-2
• REDD2Rtp801L
• regulated in development and DNA damage response 2
• RTP801L

Background

DDIT4L, also known as DNA damage-inducible transcript 4-like protein, is a 21.7 kDa 193 amino acid protein that regulates the TOR signaling pathway between the TSC1-TSC2 complex and AKT1, thus inhibiting cell growth. Current research is being conducted with diseases and disorders such as teratoma, melanoma, and hypoxia. The protein is involved in the TOR signaling pathway, where it interacts with SNRPG and PRKAB2.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: DDIT4L