Recombinant Human DDIT4L Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DDIT4L Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 94 - 193 of Human DDIT4L partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RLSSTEPCGLRGCVMHVNLEIENVCKKLDRIVCDSSVVPTFELTLVFKQENCSWTSFRDFFFSRGRFSSGFRRTLILSSGFRLVKKKLYSLIGTTVIEGS

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
DDIT4L
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DDIT4L Protein

  • DNA damage-inducible transcript 4-like protein
  • DNA-damage-inducible transcript 4-like
  • HIF-1 responsive protein RTP801-like
  • homolog of mouse SMHS1
  • Protein regulated in development and DNA damage response 2
  • REDD-2
  • REDD2Rtp801L
  • regulated in development and DNA damage response 2
  • RTP801L

Background

DDIT4L - DNA-damage-inducible transcript 4-like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP1-22966
Species: Hu, Mu
Applications: WB, ICC/IF, IP
MAB40401
Species: Hu, Mu
Applications: WB, IHC, ICC
MAB3426
Species: Hu, Mu, Rt
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB200-157
Species: Hu
Applications: WB, IHC, IHC-P
AF8962
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-87799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NB100-1595
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-46234
Species: Hu
Applications: WB, IHC
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP2-03886
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP1-91897
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DDIT4L Partial Recombinant Protein (H00115265-Q01) (0)

There are no publications for DDIT4L Partial Recombinant Protein (H00115265-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DDIT4L Partial Recombinant Protein (H00115265-Q01) (0)

There are no reviews for DDIT4L Partial Recombinant Protein (H00115265-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DDIT4L Partial Recombinant Protein (H00115265-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DDIT4L Products

Bioinformatics Tool for DDIT4L Partial Recombinant Protein (H00115265-Q01)

Discover related pathways, diseases and genes to DDIT4L Partial Recombinant Protein (H00115265-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DDIT4L Partial Recombinant Protein (H00115265-Q01)

Discover more about diseases related to DDIT4L Partial Recombinant Protein (H00115265-Q01).
 

Pathways for DDIT4L Partial Recombinant Protein (H00115265-Q01)

View related products by pathway.

PTMs for DDIT4L Partial Recombinant Protein (H00115265-Q01)

Learn more about PTMs related to DDIT4L Partial Recombinant Protein (H00115265-Q01).
 

Research Areas for DDIT4L Partial Recombinant Protein (H00115265-Q01)

Find related products by research area.

Blogs on DDIT4L

There are no specific blogs for DDIT4L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DDIT4L Antibody
NBP1-55005

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DDIT4L Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol DDIT4L