We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

DCBLD2/ESDN Recombinant Protein Antigen

Images

 
There are currently no images for DCBLD2/ESDN Protein (NBP1-85582PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DCBLD2/ESDN Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DCBLD2.

Source: E. coli

Amino Acid Sequence: AWHWRNRKKKTEGTYDLPYWDRAGWWKGMKQFLPAKAVDHEETPVRYSSSEVNHLSPREVTTVLQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DCBLD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85582.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DCBLD2/ESDN Recombinant Protein Antigen

  • CLCP1
  • CLCP11700055P21Rik
  • CUB, LCCL and coagulation factor V/VIII-homology domains protein 1
  • DCBLD2
  • discoidin, CUB and LCCL domain containing 2
  • discoidin, CUB and LCCL domain-containing protein 2
  • Endothelial and smooth muscle cell-derived neuropilin-like protein
  • ESDN
  • ESDNcoagulation factor V/VIII-homology domains protein 1

Background

DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DYC1825-2
Species: Hu, Mu, Rt
Applications: ELISA
NB100-74359
Species: Ch, Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
DVE00
Species: Hu
Applications: ELISA
NBP1-89945
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-19773
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP3-25459
Species: Hu, Rt
Applications: WB
AF3357
Species: Mu
Applications: WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
AF1042
Species: Mu
Applications: Dual ISH-IHC, IHC, WB
DPSG10
Species: Hu
Applications: ELISA
NBP2-21037
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-76544
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC,  IHC-P, IP, WB
NBP1-88866
Species: Hu
Applications: IHC,  IHC-P
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
236-EG
Species: Hu
Applications: BA
2914-HT
Species: Hu
Applications: BA

Publications for DCBLD2/ESDN Protein (NBP1-85582PEP) (0)

There are no publications for DCBLD2/ESDN Protein (NBP1-85582PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCBLD2/ESDN Protein (NBP1-85582PEP) (0)

There are no reviews for DCBLD2/ESDN Protein (NBP1-85582PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DCBLD2/ESDN Protein (NBP1-85582PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DCBLD2/ESDN Products

Research Areas for DCBLD2/ESDN Protein (NBP1-85582PEP)

Find related products by research area.

Blogs on DCBLD2/ESDN

There are no specific blogs for DCBLD2/ESDN, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DCBLD2/ESDN Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DCBLD2