DCBLD2/ESDN Antibody (3G10) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: DCBLD2/ESDN Antibody (3G10) [H00131566-M01] - Analysis of monoclonal antibody to DCBLD2 on HeLa cell . Antibody concentration 40 ug/ml.

Sandwich ELISA: DCBLD2/ESDN Antibody (3G10) [H00131566-M01] - Detection limit for recombinant GST tagged DCBLD2 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: ELISA, ICC/IF
• Clone: 3G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DCBLD2/ESDN Antibody (3G10) - Azide and BSA Free Summary

• Immunogen: DCBLD2 (NP_563615.3, 80 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. ESGTLTSINYPQTYPNSTVCEWEIRVKMGERVRIKFGDFDIEDSDSCHFNYLRIYNGIGVSRTEIGKYCGLGLQMNHSIESKGNE
• Specificity: DCBLD2 - discoidin, CUB and LCCL domain containing 2 (3G10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DCBLD2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
• Application Notes: This product is useful for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DCBLD2/ESDN Antibody (3G10) - Azide and BSA Free

• CLCP1
• CLCP11700055P21Rik
• CUB, LCCL and coagulation factor V/VIII-homology domains protein 1
• DCBLD2
• discoidin, CUB and LCCL domain containing 2
• discoidin, CUB and LCCL domain-containing protein 2
• Endothelial and smooth muscle cell-derived neuropilin-like protein
• ESDN
• ESDNcoagulation factor V/VIII-homology domains protein 1

Background

DCBLD2, otherwise known as ESDN (endothelial and smooth muscle cell-derived neuropilin-like molecule) is a novel type-I transmembrane protein with the longest cleavable secretory signal sequence among eukaryotes. It is expressed in various tissues; particularly highly expressed in cultured vascular smooth muscle cells. DCBLD2 is considered to play a role in regulation of vascular cell growth and may have a wide variety of functions in other tissues including the nervous system, like neuropilins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DCBLD2
• Entrez:
  • 131566(Human)
• Uniprot:
  • NP_563615(Human)