DCAF11 Antibody

Images

 
Western Blot: DCAF11 Antibody [NBP1-83364] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunocytochemistry/ Immunofluorescence: DCAF11 Antibody [NBP1-83364] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: DCAF11 Antibody [NBP1-83364] - Staining of human kidney shows moderate to strong positivity in tubule cells.
Western Blot: DCAF11 Antibody [NBP1-83364] - Image from verified customer review.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DCAF11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: NSKDQTIKLWDIRRFSSREGMEASRQAATQQNWDYRWQQVPKKAWRKLKLPGDSSLMTYRGHGVLHTLIRCRFSPIHSTGQQFIYSGCSTGKVVVYDLLSGHIVKKLTNHKACVRDVSWHPFEEKIVSSSWDG
Specificity
Specificity of human DCAF11 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DCAF11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
DCAF11 Protein (NBP1-83364PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DCAF11 Antibody

  • DDB1 and CUL4 associated factor 11
  • DDB1- and CUL4-associated factor 11
  • GL014
  • PRO2389
  • WD repeat domain 23
  • WD repeat-containing protein 23
  • WDR23DKFZp779A1629

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
NBP1-47839
Species: Hu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-33061
Species: Hu, Mu, Rt
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
H00001491-M01
Species: Hu, GP
Applications: WB, ELISA, IHC-P
NBP1-85871
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-47337
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NB100-598
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NBP2-46374
Species: Hu
Applications: WB, IHC
NBP1-85358
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, KD
NBP1-88795
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89751
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83364
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DCAF11 Antibody (NBP1-83364) (0)

There are no publications for DCAF11 Antibody (NBP1-83364).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DCAF11 Antibody (NBP1-83364) (0)

There are no reviews for DCAF11 Antibody (NBP1-83364). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DCAF11 Antibody (NBP1-83364) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DCAF11 Products

Bioinformatics Tool for DCAF11 Antibody (NBP1-83364)

Discover related pathways, diseases and genes to DCAF11 Antibody (NBP1-83364). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on DCAF11

There are no specific blogs for DCAF11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DCAF11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DCAF11