DC8 Recombinant Protein Antigen

Images

 
There are currently no images for DC8 Recombinant Protein Antigen (NBP2-58614PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DC8 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DC8.

Source: E. coli

Amino Acid Sequence: RKILECVIKTIKAKQEILKQYHPVVHPLDLKYDPDPAPHMENLKCRGETVAKEISEAMKSLPALIEQGE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NSL1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58614.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DC8 Recombinant Protein Antigen

  • C1orf48
  • chromosome 1 open reading frame 48
  • DC8
  • DKFZp566O1646
  • kinetochore-associated protein NSL1 homolog
  • MIS14
  • NSL1, MIND kinetochore complex component, homolog (S. cerevisiae)

Background

DC8 encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. It is part of a conserved protein complex that includes two chromodomain-containing proteins and a component of the outer plate of the kinetochore. This protein complex is proposed to bridge centromeric heterochromatin with the outer kinetochore structure. Multiple transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2359
Species: Hu
Applications: IHC, IP, WB
NB100-2586
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-88302
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-338
Species: Ha, Hu, Mar, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, PLA, WB
NBP3-13389
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-353
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC/IF, IP, WB
NB100-55251
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
H00006908-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NB500-123
Species: Hu, Mu
Applications: B/N, ChIP, Func, ICC/IF, IHC,  IHC-P, IP, WB
NBP3-27151
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82868
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-52420
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, ICC/IF, IHC,  IHC-P, WB
DY8198-05
Species: Hu
Applications: ELISA
NBP1-87511
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00010445-B01P
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3975
Species: Hu
Applications: ICC, WB
H00000699-D01P
Species: Hu, Mu
Applications: ICC/IF, PLA, WB
NBP1-82546
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB

Publications for DC8 Recombinant Protein Antigen (NBP2-58614PEP) (0)

There are no publications for DC8 Recombinant Protein Antigen (NBP2-58614PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DC8 Recombinant Protein Antigen (NBP2-58614PEP) (0)

There are no reviews for DC8 Recombinant Protein Antigen (NBP2-58614PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DC8 Recombinant Protein Antigen (NBP2-58614PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DC8 Products

Array NBP2-58614PEP

Research Areas for DC8 Recombinant Protein Antigen (NBP2-58614PEP)

Find related products by research area.

Blogs on DC8

There are no specific blogs for DC8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DC8 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol NSL1