DBT Recombinant Protein Antigen

Images

 
There are currently no images for DBT Protein (NBP1-89522PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DBT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBT.

Source: E. coli

Amino Acid Sequence: VGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DBT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89522.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DBT Recombinant Protein Antigen

  • BCATE2BCKAD E2 subunit
  • BCKADE2
  • BCKAD-E2
  • branched chain acyltransferase, E2 component
  • Branched-chain alpha-keto acid dehydrogenase complex component E2
  • Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex
  • dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease)
  • dihydrolipoamide branched chain transacylase E2
  • Dihydrolipoamide branched chain transacylase
  • dihydrolipoyl transacylase
  • Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  • E2 component of branched chain alpha-keto acid dehydrogenase complex
  • E2
  • E2B
  • EC 2.3.1.168
  • lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial
  • lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex
  • MGC9061
  • mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)

Background

The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: IHC, WB
NBP2-54301
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, IHC,  IHC-P, WB
NBP2-13961
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP1-31302
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NBP1-89150
Species: Hu
Applications: IHC,  IHC-P, WB
H00011026-M01
Species: Hu
Applications: ELISA, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
M6000B
Species: Mu
Applications: ELISA
NBP1-58268
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
H00008458-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
201-LB
Species: Hu
Applications: BA
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-89522PEP
Species: Hu
Applications: AC

Publications for DBT Protein (NBP1-89522PEP) (0)

There are no publications for DBT Protein (NBP1-89522PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBT Protein (NBP1-89522PEP) (0)

There are no reviews for DBT Protein (NBP1-89522PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DBT Protein (NBP1-89522PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DBT Products

Array NBP1-89522PEP

Research Areas for DBT Protein (NBP1-89522PEP)

Find related products by research area.

Blogs on DBT

There are no specific blogs for DBT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DBT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DBT