DBT Recombinant Protein Antigen

Images

 
There are currently no images for DBT Protein (NBP1-85963PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DBT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBT.

Source: E.coli

Amino Acid Sequence: YVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTI

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DBT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP1-85963.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for DBT Recombinant Protein Antigen

  • BCATE2BCKAD E2 subunit
  • BCKADE2
  • BCKAD-E2
  • branched chain acyltransferase, E2 component
  • Branched-chain alpha-keto acid dehydrogenase complex component E2
  • Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex
  • dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease)
  • dihydrolipoamide branched chain transacylase E2
  • Dihydrolipoamide branched chain transacylase
  • dihydrolipoyl transacylase
  • Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  • E2 component of branched chain alpha-keto acid dehydrogenase complex
  • E2
  • E2B
  • EC 2.3.1.168
  • lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial
  • lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex
  • MGC9061
  • mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-02142
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DBT Protein (NBP1-85963PEP) (0)

There are no publications for DBT Protein (NBP1-85963PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBT Protein (NBP1-85963PEP) (0)

There are no reviews for DBT Protein (NBP1-85963PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for DBT Protein (NBP1-85963PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for DBT Protein (NBP1-85963PEP)

Discover related pathways, diseases and genes to DBT Protein (NBP1-85963PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBT Protein (NBP1-85963PEP)

Discover more about diseases related to DBT Protein (NBP1-85963PEP).
 

Pathways for DBT Protein (NBP1-85963PEP)

View related products by pathway.

PTMs for DBT Protein (NBP1-85963PEP)

Learn more about PTMs related to DBT Protein (NBP1-85963PEP).
 

Research Areas for DBT Protein (NBP1-85963PEP)

Find related products by research area.

Blogs on DBT

There are no specific blogs for DBT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DBT Antibody
NBP1-89522

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DBT Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DBT