DBT Antibody

Images

 
Western Blot: DBT Antibody [H00001629-D01P] - Analysis of DBT expression in human kidney.
Western Blot: DBT Antibody [H00001629-D01P] - Analysis of DBT expression in A-431.
Western Blot: DBT Antibody [H00001629-D01P] - Analysis of DBT expression in transfected 293T cell line by DBT polyclonal antibody.Lane 1: DBT transfected lysate(53.50 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DBT Antibody Summary

Immunogen
DBT (AAH16675.1, 1 a.a. - 482 a.a.) full-length human protein. MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBT
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DBT Antibody

  • BCATE2BCKAD E2 subunit
  • BCKADE2
  • BCKAD-E2
  • branched chain acyltransferase, E2 component
  • Branched-chain alpha-keto acid dehydrogenase complex component E2
  • Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex
  • dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease)
  • dihydrolipoamide branched chain transacylase E2
  • Dihydrolipoamide branched chain transacylase
  • dihydrolipoyl transacylase
  • Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
  • E2 component of branched chain alpha-keto acid dehydrogenase complex
  • E2
  • E2B
  • EC 2.3.1.168
  • lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial
  • lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex
  • MGC9061
  • mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00011026-M01
Species: Hu
Applications: WB, ELISA
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P

Publications for DBT Antibody (H00001629-D01P) (0)

There are no publications for DBT Antibody (H00001629-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DBT Antibody (H00001629-D01P) (0)

There are no reviews for DBT Antibody (H00001629-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DBT Antibody (H00001629-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DBT Products

Bioinformatics Tool for DBT Antibody (H00001629-D01P)

Discover related pathways, diseases and genes to DBT Antibody (H00001629-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DBT Antibody (H00001629-D01P)

Discover more about diseases related to DBT Antibody (H00001629-D01P).
 

Pathways for DBT Antibody (H00001629-D01P)

View related products by pathway.

PTMs for DBT Antibody (H00001629-D01P)

Learn more about PTMs related to DBT Antibody (H00001629-D01P).
 

Research Areas for DBT Antibody (H00001629-D01P)

Find related products by research area.

Blogs on DBT

There are no specific blogs for DBT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DBT Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBT
Uniprot