DBT Antibody

Western Blot: DBT Antibody [H00001629-B01P] - Analysis of DBT expression in human liver.

Western Blot: DBT Antibody [H00001629-B01P] - Analysis of DBT expression in A-431.

Western Blot: DBT Antibody [H00001629-B01P] - Analysis of DBT expression in transfected 293T cell line by DBT polyclonal antibody. Lane 1: DBT transfected lysate(53.02 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

DBT Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: DBT (AAH16675.1, 1 a.a. - 482 a.a.) full-length human protein. MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLSTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK
• Specificity: Reacts with dihydrolipoamide branched chain transacylase E2.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: DBT
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: This antibody is reactive against tissue and transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DBT Antibody

• BCATE2BCKAD E2 subunit
• BCKADE2
• BCKAD-E2
• branched chain acyltransferase, E2 component
• Branched-chain alpha-keto acid dehydrogenase complex component E2
• Dihydrolipoamide acetyltransferase component of branched-chain alpha-keto aciddehydrogenase complex
• dihydrolipoamide branched chain transacylase (E2 component of branched chainketo acid dehydrogenase complex; maple syrup urine disease)
• dihydrolipoamide branched chain transacylase E2
• Dihydrolipoamide branched chain transacylase
• dihydrolipoyl transacylase
• Dihydrolipoyllysine-residue (2-methylpropanoyl)transferase
• E2 component of branched chain alpha-keto acid dehydrogenase complex
• E2
• E2B
• EC 2.3.1.168
• lipoamide acyltransferase component of branched-chain alpha-keto aciddehydrogenase complex, mitochondrial
• lipoamide acyltransferase component of mitochondrial branched-chain alpha-ketoacid dehydrogenase complex
• MGC9061
• mitochondrial branched chain alpha-keto acid dehydrogenase transacylase subunit(E2b)

Background

The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought to be composed of a core of 24 transacylase (E2) subunits, and associated decarboxylase (E1), dehydrogenase (E3), and regulatory subunits. This gene encodes the transacylase (E2) subunit. Mutations in this gene result in maple syrup urine disease, type 2. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for DBT Antibody (H00001629-B01P)(1)

Publication using H00001629-B01P

• Johnson MA, Vidoni S, Durigon R et al. Amino Acid starvation has opposite effects on mitochondrial and cytosolic protein synthesis. PLoS One. 2014-04-09 [PMID: 24718614]

Bioinformatics

• Gene Symbol: DBT
• Entrez:
  • 1629(Human)
• Uniprot:
  • AAH16675.1(Human)