DAZAP2 Antibody (3G21) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: DAZAP2 Antibody (3G21) [H00009802-M01] - Analysis of monoclonal antibody to DAZAP2 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: DAZAP2 Antibody (3G21) [H00009802-M01] - Detection limit for recombinant GST tagged DAZAP2 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF
• Clone: 3G21
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

DAZAP2 Antibody (3G21) - Azide and BSA Free Summary

• Immunogen: DAZAP2 (NP_055579, 93 a.a. ~ 168 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. PVGPIYPPGSTVLVEGGYDAGARFGAGATAGNIPPPPPGCPPNAAQLAVMQGANVLVTQRKGNFFMGGSDGGYTIW
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: DAZAP2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot
• Application Notes: This antibody is useful for ELISA, Western Blot

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DAZAP2 Antibody (3G21) - Azide and BSA Free

• DAZ associated protein 2
• deleted in azoospermia associated protein 2
• Deleted in azoospermia-associated protein 2
• KIAA0058DAZ-associated protein 2
• MGC14319
• MGC766
• proline-rich transcript in brain
• proline-rich transcript, brain-expressed protein
• PRTB

Background

DAZAP2, also known as DAZ-associated protein2, consists of five isoforms of sizes 17.3 kDa, 16.1 kDa, 14 kDa, 9 kDa, and 22.8 kDa and is involved in interactions with DAZ proteins and transforming growth factor signaling molecules. This protein is being studied for connection to disorders and diseases such as multiple myeloma, brachydactyly, ataxia, prostatitis, and azoospermia. The protein interacts in pathways including cell signaling, transcription regulation, spermatogenesis, and RNA splicing, which also involve POLI, RHOXF2, BATF2, EXD3, and ZFAND2B proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DAZAP2
• Uniprot:
  • NP_055579(Human)