Daxx Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DAXX. Source: E. coli
Amino Acid Sequence: DEEEEAAAGKDGDKSPMSSLQISNEKNLEPGKQISRSSGEQQNKGRIVSPSLLSEEPLAPSSIDAESNGEQPEELTLEEESPVSQLFELEIEALPLDTPSSVETDISSSRKQSEEPFTTVLENGAGMVSSTSFNGGVSPHNWGDSG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
DAXX |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85309. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for Daxx Recombinant Protein Antigen
Background
Daxx (death-domain-associated protein) was originally identified as a cytoplasmic protein that binds to the death domain of the transmembrane death receptor Fas. It is now that known that the a large porportion of Daxx molecules are nuclear and associate with the promyelocytic leukaemia nuclear body (PML-NB) and other subnuclear domains (reviewed in Salomoni and Khelifi). The promyelocytic leukemia protein Pml is an essential component of the PML-NB. Data suggests that certain stimuli including Fas stimulation, causes Daxx to be translocated from the nucleus to the cytoplasm. Daxx is ubiquitously expressed, and particularly high levels of Daxx have been reported in the thymus and testes. At the cellular level Daxx may be found in cytoplasm and within heterochromatic regions of the nucleus. Daxx has been reported to interact and co-localize with Pml in the nucleus of tumor cell lines and primary cells. Pml is necessary for Fas-induced cell death and Daxx pro-apoptotic functions. Daxx is thought to have both pro- and anti-apoptotic functions depending on the stimulus and the cell type. Daxx pro-apoptotic functions appear to occur in both the cytoplasm and nucleus. Although the mechanisms remain to be fully elucidated, research indicates that Daxx plays a role in the pathology of human diseases including cancer and neurodegerative disorders. Human Daxx is a 740 amino acid protein (GenBank no. gi/62898369).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC, IHC-P, IP, KD, PLA, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, Micro, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC, WB
Species: Hu
Applications: ELISA
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu
Applications: AC
Publications for Daxx Protein (NBP1-85309PEP) (0)
There are no publications for Daxx Protein (NBP1-85309PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Daxx Protein (NBP1-85309PEP) (0)
There are no reviews for Daxx Protein (NBP1-85309PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for Daxx Protein (NBP1-85309PEP) (0)
Additional Daxx Products
Research Areas for Daxx Protein (NBP1-85309PEP)
Find related products by research area.
|
Blogs on Daxx