DARC Antibody

Images

 
Western Blot: DARC Antibody [H00002532-D01P] - Analysis of DARC expression in mouse stomach.
Western Blot: DARC Antibody [H00002532-D01P] - Analysis of DARC expression in IMR-32.
Western Blot: DARC Antibody [H00002532-D01P] - Analysis of DARC expression in transfected 293T cell line by DARC polyclonal antibody.Lane 1: DARC transfected lysate(35.60 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DARC Antibody Summary

Immunogen
DARC (NP_002027.2, 1 a.a. - 336 a.a.) full-length human protein. MGNCLHRAELSPSTENSSQLDFEDVWNSSYGVNDSFPDGDYGANLEAAAPCHSCNLLDDSALPFFILTSVLGILASSTVLFMLFRPLFRWQLCPGWPVLAQLAVGSALFSIVVPVLAPGLGSTRSSALCSLGYCVWYGSAFAQALLLGCHASLGHRLGAGQVPGLTLGLTVGIWGVAALLTLPVTLASGASGGLCTLIYSTELKALQATHTVACLAIFVLLPLGLFGAKGLKKALGMGPGPWMNILWAWFIFWWPHGVVLGLDFLVRSKLLLLSTCLAQQALDLLLNLAEALAILHCVATPLLLALFCHQATRTLLPSLPLPEGWSSHLDTLGSKS
Specificity
Reacts with Duffy blood group, chemokine receptor.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DARC
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is reactive against transfected lysate in WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for DARC Antibody

  • ACKR1
  • CCBP1
  • CD234 antigen
  • CD234
  • DARC
  • Dfy
  • Duffy Antigen
  • Duffy antigen/chemokine receptor
  • Duffy blood group antigen
  • Duffy blood group, chemokine receptor
  • Fy Antigen
  • Fy glycoprotein
  • FYDuffy blood group
  • Glycoprotein D
  • GPD
  • GPDWBCQ1
  • GpFy
  • Plasmodium vivax receptor

Background

The protein encoded by this gene is a glycosylated membrane protein and a non-specific receptor for several chemokines. The encoded protein is the receptor for the human malarial parasites Plasmodium vivax and Plasmodium knowlesi. Polymorphisms in this gene are the basis of the Duffy blood group system. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76690
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-07087
Species: Hu
NBP1-69668
Species: Hu
Applications: WB
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB1228
Species: Hu
Applications: Flow, IHC, IP, CyTOF-ready
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
AF4409
Species: Mu
Applications: WB
MAB3857
Species: Hu
Applications: WB
H00005236-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP, RNAi
NBP1-88824
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
H00002532-D01P
Species: Hu, Mu
Applications: WB

Publications for DARC Antibody (H00002532-D01P) (0)

There are no publications for DARC Antibody (H00002532-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DARC Antibody (H00002532-D01P) (0)

There are no reviews for DARC Antibody (H00002532-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DARC Antibody (H00002532-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DARC Products

Bioinformatics Tool for DARC Antibody (H00002532-D01P)

Discover related pathways, diseases and genes to DARC Antibody (H00002532-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DARC Antibody (H00002532-D01P)

Discover more about diseases related to DARC Antibody (H00002532-D01P).
 

Pathways for DARC Antibody (H00002532-D01P)

View related products by pathway.

PTMs for DARC Antibody (H00002532-D01P)

Learn more about PTMs related to DARC Antibody (H00002532-D01P).
 

Research Areas for DARC Antibody (H00002532-D01P)

Find related products by research area.

Blogs on DARC

There are no specific blogs for DARC, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DARC Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DARC
Entrez
Uniprot