DAP5 Recombinant Protein Antigen

Images

 
There are currently no images for DAP5 Protein (NBP1-85310PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

DAP5 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human EIF4G2.

Source: E. coli

Amino Acid Sequence: KYSSLYAQLCLRLAEDAPNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLLPEEEEQRAIAKIKMLGNIKFIGELGKLDLIHESILHKCIKTLLEKKKRVQLKDMGEDLECLCQIMRTVGPRLDHERAKS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
EIF4G2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85310. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for DAP5 Recombinant Protein Antigen

  • aging-associated protein 1
  • DAP-5
  • DAP5AAG1
  • Death-associated protein 5
  • eIF4G 2
  • eIF-4G 2
  • eIF-4-gamma 2
  • eukaryotic translation initiation factor 4 gamma 2
  • eukaryotic translation initiation factor 4 gamma, 2
  • eukaryotic translation initiation factor 4G-like 1
  • FLJ41344
  • NAT1
  • p97

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33751
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-92167
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-84310
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-61829
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
NBP2-02300
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NBP1-85310PEP
Species: Hu
Applications: AC

Publications for DAP5 Protein (NBP1-85310PEP) (0)

There are no publications for DAP5 Protein (NBP1-85310PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP5 Protein (NBP1-85310PEP) (0)

There are no reviews for DAP5 Protein (NBP1-85310PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for DAP5 Protein (NBP1-85310PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP5 Products

Research Areas for DAP5 Protein (NBP1-85310PEP)

Find related products by research area.

Blogs on DAP5

There are no specific blogs for DAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our DAP5 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G2