Recombinant Human DAP5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAP5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-79 of Human EIF4G2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SFKPVMQKFLHDHVDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFLAWKEDITQEFPGKGKALFQVNQ

Protein/Peptide Type
Partial Recombinant Protein
Gene
EIF4G2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAP5 Protein

  • aging-associated protein 1
  • DAP-5
  • DAP5AAG1
  • Death-associated protein 5
  • eIF4G 2
  • eIF-4G 2
  • eIF-4-gamma 2
  • eukaryotic translation initiation factor 4 gamma 2
  • eukaryotic translation initiation factor 4 gamma, 2
  • eukaryotic translation initiation factor 4G-like 1
  • FLJ41344
  • NAT1
  • p97

Background

EIF4G2 - eukaryotic translation initiation factor 4 gamma, 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33751
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59311
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC
NBP1-92167
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
NB100-268
Species: Hu, Rt, Po
Applications: WB, IP
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13676
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC-P
NBP2-46289
Species: Hu
Applications: WB, IHC
AF5758
Species: Hu
Applications: WB, IHC, ICC
NB100-81898
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02300
Species: Hu
Applications: WB, Flow, IHC, IHC-P
H00001982-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for DAP5 Partial Recombinant Protein (H00001982-Q01) (0)

There are no publications for DAP5 Partial Recombinant Protein (H00001982-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP5 Partial Recombinant Protein (H00001982-Q01) (0)

There are no reviews for DAP5 Partial Recombinant Protein (H00001982-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAP5 Partial Recombinant Protein (H00001982-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP5 Products

Bioinformatics Tool for DAP5 Partial Recombinant Protein (H00001982-Q01)

Discover related pathways, diseases and genes to DAP5 Partial Recombinant Protein (H00001982-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP5 Partial Recombinant Protein (H00001982-Q01)

Discover more about diseases related to DAP5 Partial Recombinant Protein (H00001982-Q01).
 

Pathways for DAP5 Partial Recombinant Protein (H00001982-Q01)

View related products by pathway.

PTMs for DAP5 Partial Recombinant Protein (H00001982-Q01)

Learn more about PTMs related to DAP5 Partial Recombinant Protein (H00001982-Q01).
 

Research Areas for DAP5 Partial Recombinant Protein (H00001982-Q01)

Find related products by research area.

Blogs on DAP5

There are no specific blogs for DAP5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

DAP5 Antibody
NBP1-85310

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAP5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G2