DAP5 Antibody [Alexa Fluor® 750]

Images

 

Product Details

Summary
Product Discontinued
View other related DAP5 Primary Antibodies

Order Details


    • Catalog Number
      NBP3-38020AF750
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

DAP5 Antibody [Alexa Fluor® 750] Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 320-490 of human DAP5 (NP_001409.3).

Sequence:
PKTINQIRQDAVKDLGVFIPAPMAQGMRSDFFLEGPFMPPRMKMDRDPLGGLADMFGQMPGSGIGTGPGVIQDRFSPTMGRHRSNQLFNGHGGHIMPPTQSQFGEMGGKFMKSQGLSQLYHNQSQGLLSQLQGQSKDMPPRFSKKGQLNADEISLRPAQSFLMNKNQVPKL
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
EIF4G2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Immunoprecipitation
  • Western Blot
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
Affinity purified

Notes



Alexa Fluor (R) products are provided under an intellectual property license from Life Technologies Corporation. The purchase of this product conveys to the buyer the non-transferable right to use the purchased product and components of the product only in research conducted by the buyer (whether the buyer is an academic or for-profit entity). The sale of this product is expressly conditioned on the buyer not using the product or its components, or any materials made using the product or its components, in any activity to generate revenue, which may include, but is not limited to use of the product or its components: (i) in manufacturing; (ii) to provide a service, information, or data in return for payment; (iii) for therapeutic, diagnostic or prophylactic purposes; or (iv) for resale, regardless of whether they are resold for use in research. For information on purchasing a license to this product for purposes other than as described above, contact Life Technologies Corporation, 5791 Van Allen Way, Carlsbad, CA 92008 USA or outlicensing@lifetech.com. This conjugate is made on demand. Actual recovery may vary from the stated volume of this product. The volume will be greater than or equal to the unit size stated on the datasheet.

Alternate Names for DAP5 Antibody [Alexa Fluor® 750]

  • aging-associated protein 1
  • DAP-5
  • DAP5AAG1
  • Death-associated protein 5
  • eIF4G 2
  • eIF-4G 2
  • eIF-4-gamma 2
  • eukaryotic translation initiation factor 4 gamma 2
  • eukaryotic translation initiation factor 4 gamma, 2
  • eukaryotic translation initiation factor 4G-like 1
  • FLJ41344
  • NAT1
  • p97

Background

Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. The protein encoded by this gene shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3; eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, this gene product functions as a general repressor of translation by forming translationally inactive complexes. In vitro and in vivo studies indicate that translation of this mRNA initiates exclusively at a non-AUG (GUG) codon. Alternatively spliced transcript variants encoding different isoforms of this gene have been described.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33751
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-59311
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-92167
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NB100-268
Species: Hu, Po
Applications: IP, WB
NB600-326
Species: ET
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-1558
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-32733
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13677
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-61829
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
AF5758
Species: Hu
Applications: ICC, IHC, WB
NB100-81898
Species: Hu, Po
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1343
Species: Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP3-38020AF750
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IP

Publications for DAP5 Antibody (NBP3-38020AF750) (0)

There are no publications for DAP5 Antibody (NBP3-38020AF750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP5 Antibody (NBP3-38020AF750) (0)

There are no reviews for DAP5 Antibody (NBP3-38020AF750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DAP5 Antibody (NBP3-38020AF750) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional DAP5 Products

Array NBP3-38020AF750

Research Areas for DAP5 Antibody (NBP3-38020AF750)

Find related products by research area.

Blogs on DAP5

There are no specific blogs for DAP5, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DAP5 Antibody [Alexa Fluor® 750] and receive a gift card or discount.

Bioinformatics

Gene Symbol EIF4G2