Recombinant Human DAP12 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human DAP12 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-113 of Human TYROBP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGGLEPCSRLLLLPLLLAVSGLRPVQAQAQSDCSCSTVSPGVLAGIVMGDLVLTVLIALAVYFLGRLVPRGRGAAEAATRKQRITETESPYQELQGQRSDVYSDLNTQRPYYK

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
TYROBP
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human DAP12 Protein

  • DAP12
  • DAP12PLOSL
  • DNAX-activation protein 12
  • KARAP
  • KARAPPLO-SL
  • KAR-associated protein
  • killer activating receptor associated protein
  • Killer-activating receptor-associated protein
  • TYRO protein tyrosine kinase binding protein
  • TYRO protein tyrosine kinase-binding protein
  • TYROBP

Background

This gene encodes a transmembrane signaling polypeptide which contains an immunoreceptor tyrosine-based activation motif (ITAM) in its cytoplasmic domain. The encoded protein may associate with the killer-cell inhibitory receptor (KIR) family of membrane glycoproteins and may act as an activating signal transduction element. This protein may bind zeta-chain (TCR) associated protein kinase 70kDa (ZAP-70) and spleen tyrosine kinase (SYK) and play a role in signal transduction, bone modeling, brain myelination, and inflammation. Mutations within this gene have been associated with polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy (PLOSL), also known as Nasu-Hakola disease. Its putative receptor, triggering receptor expressed on myeloid cells 2 (TREM2), also causes PLOSL. Two alternative transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants have been described, but their full-length nature has not been deterimined. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-55403
Species: Hu
Applications: WB, PEP-ELISA
NBP1-07101
Species: Hu, Mu
Applications: WB, Simple Western, ELISA, Flow, ICC/IF
MAB1187
Species: Mu
Applications: WB, Flow, AgAct, CyTOF-ready, ICC
MAB139
Species: Hu
Applications: WB, Flow, CostimT, CyTOF-ready, Neut
NBL1-16115
Species: Hu
NBP2-16456
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
2249-NK
Species: Hu
MAB2384
Species: Hu
Applications: WB, Flow, CyTOF-ready
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
NB100-56508
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P, CyTOF-ready, Flow-CS
MAB1059
Species: Hu
Applications: Flow, CyTOF-ready

Publications for DAP12 Recombinant Protein (H00007305-P01) (0)

There are no publications for DAP12 Recombinant Protein (H00007305-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DAP12 Recombinant Protein (H00007305-P01) (0)

There are no reviews for DAP12 Recombinant Protein (H00007305-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for DAP12 Recombinant Protein (H00007305-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional DAP12 Products

Bioinformatics Tool for DAP12 Recombinant Protein (H00007305-P01)

Discover related pathways, diseases and genes to DAP12 Recombinant Protein (H00007305-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DAP12 Recombinant Protein (H00007305-P01)

Discover more about diseases related to DAP12 Recombinant Protein (H00007305-P01).
 

Pathways for DAP12 Recombinant Protein (H00007305-P01)

View related products by pathway.

PTMs for DAP12 Recombinant Protein (H00007305-P01)

Learn more about PTMs related to DAP12 Recombinant Protein (H00007305-P01).
 

Research Areas for DAP12 Recombinant Protein (H00007305-P01)

Find related products by research area.

Blogs on DAP12

There are no specific blogs for DAP12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human DAP12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TYROBP
Entrez