D4S234E Antibody

Images

 
Western Blot: D4S234E Antibody [NBP3-10584] - Western blot analysis of D4S234E in Rat Testis lysates. Antibody dilution at 1.0ug/ml

Product Details

Summary
Reactivity RtSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

D4S234E Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Rat D4S234E (NP_077042). Peptide sequence VKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKTE
Clonality
Polyclonal
Host
Rabbit
Gene
NSG1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Theoretical MW
20 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS buffer, 2% sucrose.
Preservative
0.09% Sodium Azide
Purity
Affinity purified

Alternate Names for D4S234E Antibody

  • carboxyterminally EE-tagged neuron-enriched endosomal 21 kDa protein
  • D4S234Brain neuron cytoplasmic protein 1
  • DNA segment on chromosome 4 (unique) 234 expressed sequence
  • NEEP21
  • neuron-specific protein family member 1
  • NSG1
  • P21

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67484
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-68858
Species: Hu
Applications: IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
H00003429-A01
Species: Hu
Applications: ELISA, IHC, IHC-Fr, WB
NBP2-47561
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-03198
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90949
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-00776
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB500-106
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
AF1555
Species: Hu
Applications: WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NBP1-28566
Species: Bv, Hu, Pm, Mu, Po, Rt
Applications: Func, IHC, IHC-Fr, IHC-P, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB
NBP1-31308
Species: Bv, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MAB7557
Species: Hu
Applications: IHC, WB
NBP3-10584
Species: Rt
Applications: WB

Publications for D4S234E Antibody (NBP3-10584) (0)

There are no publications for D4S234E Antibody (NBP3-10584).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for D4S234E Antibody (NBP3-10584) (0)

There are no reviews for D4S234E Antibody (NBP3-10584). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for D4S234E Antibody (NBP3-10584) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional D4S234E Products

Bioinformatics Tool for D4S234E Antibody (NBP3-10584)

Discover related pathways, diseases and genes to D4S234E Antibody (NBP3-10584). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for D4S234E Antibody (NBP3-10584)

Discover more about diseases related to D4S234E Antibody (NBP3-10584).
 

Pathways for D4S234E Antibody (NBP3-10584)

View related products by pathway.

PTMs for D4S234E Antibody (NBP3-10584)

Learn more about PTMs related to D4S234E Antibody (NBP3-10584).
 

Research Areas for D4S234E Antibody (NBP3-10584)

Find related products by research area.

Blogs on D4S234E

There are no specific blogs for D4S234E, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our D4S234E Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NSG1