Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

Images

 
Western Blot: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-84786] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-192
Orthogonal Strategies: Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-84786] - Staining in human small intestine and pancreas tissues using anti-SULT1E1 antibody. ...read more
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-84786] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-84786] - Staining of human small intestine shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: VKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEI
Specificity
Specificity of human Cytosolic Sulfotransferase 1E1/SULT1E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT1E1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
WB reported in scientific literature (PMID: 22414680). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytosolic Sulfotransferase 1E1/SULT1E1 Protein (NBP1-84786PEP)
Publications
Read Publication using NBP1-84786.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 22414680)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

  • Cytosolic Sulfotransferase 1E1
  • EC 2.8.2
  • EST-1
  • ESTMGC34459
  • estrone sulfotransferase
  • ST1E1
  • STE
  • STEestrogen sulfotransferase
  • Sulfotransferase 1E1
  • sulfotransferase family 1E, estrogen-preferring, member 1
  • Sulfotransferase, estrogen-preferringEC 2.8.2.4
  • SULT1E1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-61764
Species: Hu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-02042
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-1596
Species: Hu, Rt, Pm, Rb
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-76871
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
NB120-2765
Species: Hu, Mu, Rt, Bv, Ch, Gp, Pm, Rb, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53246
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-41387
Species: Hu
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA, S-ELISA
H00347527-P01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84786
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786)(1)

We have publications tested in 1 application: WB.


Filter By Application
WB
(1)
All Applications
Filter By Species
All Species

Reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786) (0)

There are no reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cytosolic Sulfotransferase 1E1/SULT1E1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786)

Discover more about diseases related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786).
 

Pathways for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786)

Learn more about PTMs related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786).
 

Research Areas for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84786)

Find related products by research area.

Blogs on Cytosolic Sulfotransferase 1E1/SULT1E1

There are no specific blogs for Cytosolic Sulfotransferase 1E1/SULT1E1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1E1