Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

Images

 
Western Blot: Estrogen Sulfotransferase Antibody [NBP1-84785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression ...read more
Immunohistochemistry-Paraffin: Estrogen Sulfotransferase Antibody [NBP1-84785] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPEL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT1E1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytosolic Sulfotransferase 1E1/SULT1E1 Protein (NBP1-84785PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

  • Cytosolic Sulfotransferase 1E1
  • EC 2.8.2
  • EST-1
  • ESTMGC34459
  • estrone sulfotransferase
  • ST1E1
  • STE
  • STEestrogen sulfotransferase
  • Sulfotransferase 1E1
  • sulfotransferase family 1E, estrogen-preferring, member 1
  • Sulfotransferase, estrogen-preferringEC 2.8.2.4
  • SULT1E1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF5828
Species: Hu
Applications: WB, ICC, Neut
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
AF9024
Species: Mu, Rt
Applications: WB, IHC
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00347527-B01P
Species: Hu
Applications: WB, ELISA
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-84785
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785) (0)

There are no publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785) (0)

There are no reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytosolic Sulfotransferase 1E1/SULT1E1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Discover more about diseases related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785).
 

Pathways for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Learn more about PTMs related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785).
 

Research Areas for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Find related products by research area.

Blogs on Cytosolic Sulfotransferase 1E1/SULT1E1

There are no specific blogs for Cytosolic Sulfotransferase 1E1/SULT1E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1E1
Entrez