Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody


Western Blot: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-84785] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: more
Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-84785] - Staining of human liver shows moderate cytoplasmic and nuclear positivity in hepatocytes.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPEL
Specificity of human Cytosolic Sulfotransferase 1E1/SULT1E1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytosolic Sulfotransferase 1E1/SULT1E1 Protein (NBP1-84785PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

  • Cytosolic Sulfotransferase 1E1
  • EC 2.8.2
  • EST-1
  • ESTMGC34459
  • estrone sulfotransferase
  • ST1E1
  • STE
  • STEestrogen sulfotransferase
  • Sulfotransferase 1E1
  • sulfotransferase family 1E, estrogen-preferring, member 1
  • Sulfotransferase, estrogen-preferringEC
  • SULT1E1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Hu, Ca
Applications: WB, Flow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: WB, IHC, IP
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785) (0)

There are no publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785) (0)

There are no reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytosolic Sulfotransferase 1E1/SULT1E1 Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Discover more about diseases related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785).

Pathways for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Learn more about PTMs related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785).

Research Areas for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-84785)

Find related products by research area.

Blogs on Cytosolic Sulfotransferase 1E1/SULT1E1

There are no specific blogs for Cytosolic Sulfotransferase 1E1/SULT1E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody and receive a gift card or discount.


Gene Symbol SULT1E1