Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody - BSA Free

Western Blot: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-56977] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Immunohistochemistry-Paraffin: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-56977] - STS (steroid sulfatase) and Cytosolic Sulfotransferase 1E1/SULT1E1 (estrogen sulfotransferase 1E1) in high-grade serous ovarian carcinoma. Immunoreactivity of STS and Cytosolic Sulfotransferase 1E1/SULT1E1 is demonstrated in paraffin-embedded tissue sections from ovarian carcinoma. Sections were probed with an antibody against STS and Cytosolic Sulfotransferase 1E1/SULT1E1 (NBP1-56977), respectively. STS and SULT1E immunoreactivity is visible in the cancer cells (C). ST = tumor stroma, BV = blood vessel. Image collected and cropped by CiteAb from the following publication (//www.hindawi.com/journals/jdd/2013/957605/), licensed under a CC-BY license.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFY The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SULT1E1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
• Application Notes: Immunohistochemistry-Paraffin was reported in scientific literature.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody - BSA Free

• Cytosolic Sulfotransferase 1E1
• EC 2.8.2
• EST-1
• ESTMGC34459
• estrone sulfotransferase
• ST1E1
• STE
• STEestrogen sulfotransferase
• Sulfotransferase 1E1
• sulfotransferase family 1E, estrogen-preferring, member 1
• Sulfotransferase, estrogen-preferringEC 2.8.2.4
• SULT1E1

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)(2)

Publications using NBP1-56977

• Vulpio C, Bossola M, Di Stasio E et al. Histology and immunohistochemistry of the parathyroid glands in renal secondary hyperparathyroidism refractory to vitamin D or cinacalcet therapy. Eur J Endocrinol. 2013-04-29 [PMID: 23520248] (IHC-P, Human)
• Secky L, Svoboda M, Klameth L et al. The sulfatase pathway for estrogen formation: targets for the treatment and diagnosis of hormone-associated tumors. J Drug Deliv 2013-01-01 [PMID: 23476785] (IHC-P, Human)

Bioinformatics

• Gene Symbol: SULT1E1
• Uniprot:
  • P49888()