Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

Images

 
Western Blot: Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody [NBP1-56977] - HepG2 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody Summary

Immunogen
Synthetic peptides corresponding to SULT1E1 (sulfotransferase family 1E, estrogen-preferring, member 1) The peptide sequence was selected from the middle region of SULT1E1. Peptide sequence LMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLF
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SULT1E1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
Application Notes
This is a rabbit polyclonal antibody against SULT1E1 and was validated on Western blot. Immunohistochemistry-Paraffin was reported in scientific literature.
Publications
Read Publications using
NBP1-56977 in the following applications:

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody

  • Cytosolic Sulfotransferase 1E1
  • EC 2.8.2
  • EST-1
  • ESTMGC34459
  • estrone sulfotransferase
  • ST1E1
  • STE
  • STEestrogen sulfotransferase
  • Sulfotransferase 1E1
  • sulfotransferase family 1E, estrogen-preferring, member 1
  • Sulfotransferase, estrogen-preferringEC 2.8.2.4
  • SULT1E1

Background

Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene encodes a protein that transfers a sulfo moiety to and from estrone, which may control levels of estrogen receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-03227
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-32604
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-11538
Species: Hu, Mu, Rt
Applications: WB, IHC-P
AF6174
Species: Hu
Applications: WB, IHC, IP
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-03523
Species: Hu, Ca
Applications: WB, Flow
NBP2-13961
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-47645
Species: Hu, Mu, Rt
Applications: Flow, IHC-P, PAGE, IF
NBP1-85818
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00347527-P01
Species: Hu
MAB25031
Species: Hu
Applications: WB, IHC, IP
NBP1-56977
Species: Hu
Applications: WB, IHC, IHC-P

Publications for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(2)
All Applications
Filter By Species
Human
(2)
All Species

Reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977) (0)

There are no reviews for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)

Discover related pathways, diseases and genes to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)

Discover more about diseases related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977).
 

Pathways for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)

View related products by pathway.

PTMs for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)

Learn more about PTMs related to Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977).
 

Research Areas for Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody (NBP1-56977)

Find related products by research area.

Blogs on Cytosolic Sulfotransferase 1E1/SULT1E1

There are no specific blogs for Cytosolic Sulfotransferase 1E1/SULT1E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytosolic Sulfotransferase 1E1/SULT1E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SULT1E1
Uniprot