Cytokeratin, HMW Antibody

Images

 
Immunohistochemistry-Paraffin: Cytokeratin, HMW Antibody [NBP1-81647] - Staining of human skin shows positivity in keratinized layer and basal cells of epidermis.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytokeratin, HMW Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KRT76
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
IHC, ICC/IF reported in scientific literature (PMID: 25340345). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Cytokeratin, HMW Protein (NBP1-81647PEP)
Publications
Read Publications using
NBP1-81647 in the following applications:

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%). Mouse reactivity reported in the scientific literature (PMID: 25340345)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytokeratin, HMW Antibody

  • CK-2P
  • cytokeratin 2
  • Cytokeratin-2P
  • HUMCYT2A
  • K2P
  • K76
  • keratin 76
  • keratin, type II cytoskeletal 2 oral
  • keratin-76
  • KRT2Bcytokeratin-2P
  • KRT2Pkeratin 2p
  • KRT76
  • Type-II keratin Kb9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-42202
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB110-41535
Species: Bv, Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
NBP2-84109
Species: Hu
Applications: IHC, IHC-P, WB
H00054207-M03
Species: Hu
Applications: ELISA, WB
NBP1-77097
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-32432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-67279
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAB1225
Species: Hu
Applications: Block, CyTOF-reported, Flow
NBP1-58906
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-76940
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP1-32728
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-80271
Species: Hu, Mu
Applications: IHC, IHC-P, WB
DTM100
Species: Hu
Applications: ELISA
NBP1-20149
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, WB
AF-258-PB
Species: Hu
Applications: IHC, Simple Western, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81647
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P

Publications for Cytokeratin, HMW Antibody (NBP1-81647)(2)

We have publications tested in 1 confirmed species: Mouse.

We have publications tested in 2 applications: ICC/IF, IHC.


Filter By Application
ICC/IF
(1)
IHC
(1)
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Cytokeratin, HMW Antibody (NBP1-81647) (0)

There are no reviews for Cytokeratin, HMW Antibody (NBP1-81647). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cytokeratin, HMW Antibody (NBP1-81647) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Cytokeratin, HMW Products

Bioinformatics Tool for Cytokeratin, HMW Antibody (NBP1-81647)

Discover related pathways, diseases and genes to Cytokeratin, HMW Antibody (NBP1-81647). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on Cytokeratin, HMW

There are no specific blogs for Cytokeratin, HMW, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytokeratin, HMW Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT76