Cytokeratin, HMW Antibody - BSA Free

Immunohistochemistry-Paraffin: Cytokeratin, HMW Antibody [NBP1-81647] - Staining of human skin shows positivity in keratinized layer and basal cells of epidermis.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Cytokeratin, HMW Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LETKWELLQQQTTGSGPSSLEPCFESYISFLCKQLDSLLGERGNLEGELKSMQDLVEDFK
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT76
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  Cytokeratin, HMW Protein (NBP1-81647PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (81%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Cytokeratin, HMW Antibody - BSA Free

• CK-2P
• cytokeratin 2
• Cytokeratin-2P
• HUMCYT2A
• K2P
• K76
• keratin 76
• keratin, type II cytoskeletal 2 oral
• keratin-76
• KRT2Bcytokeratin-2P
• KRT2Pkeratin 2p
• KRT76
• Type-II keratin Kb9

Background

KRT76, also known as Keratin, type II cytoskeletal 2 oral, is a 638 amino acid that is approx. 66 kDa, belongs to the intermediate filament family responsible for the structural integrity of epithelial cells, subdivided into epithelial keratins and hair keratins, and probably contributes to terminal cornification. Studies are being performed in relation to this protein and obstructive jaundice, pharyngitis, jaundice, cervical cancer, neuronitis, colorectal cancer, cervicitis, interferon and hepatitis. This protein has been shown to have interactions with ATG13, PDPK1, ULK2, GABARAP, and PRKAA1 in cytoskeleton organization pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytokeratin, HMW Antibody (NBP1-81647)(2)

Publications using NBP1-81647

• DiTommaso T, Cottle DL, Pearson HB et al. Keratin 76 Is Required for Tight Junction Function and Maintenance of the Skin Barrier. PLoS Genet 2014-10-01 [PMID: 25340345] (IF/IHC, ICC/IF, Mouse)
• Ambatipudi S, Bhosale PG, Heath E et al. Downregulation of Keratin 76 Expression during Oral Carcinogenesis of Human, Hamster and Mouse. PLoS One 2013-01-01 [PMID: 23936238]

Bioinformatics

• Gene Symbol: KRT76