Home » Cytokeratin 4 » Cytokeratin 4 Proteins » Recombinant Human Cytokeratin 4 Protein

Recombinant Human Cytokeratin 4 Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

100% Guarantee on every product

Recombinant Human Cytokeratin 4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 194-300 of Human Cytokeratin 4

Source: Wheat Germ

Amino Acid Sequence: SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTH
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KRT4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytokeratin 4 Protein

  • CK4
  • CK-4
  • CYK4cytokeratin-4
  • Cytokeratin-4
  • FLJ31692
  • K4cytokeratin 4
  • keratin 4
  • keratin, type II cytoskeletal 4
  • Keratin-4
  • Type-II keratin Kb4

Background

KRT4 - keratin 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Histone H3 Antibody
NB500-171
Western Blot: Histone H3 Antibody [NB500-171] - Analysis of HeLa, COS, C6, and K562 cell lysate using histone H3 antibody [NB500-171] antibody at 1:100.
Western Blot: Histone H3 Antibody [NB500-171] - Total histone H3 levels in MCF-7 and HCT-116 cells. Image from verified customer review.
Western Blot: Histone H3 Antibody [NB500-171] - (1) HeLa, (2) S. cerevisiae whole cell lysates, (3) Histones purified from HeLa cells.
(4 Reviews)
(9 Publications)
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Cytokeratin 13
Antibody
NBP2-38166
Western Blot: Cytokeratin 13 Antibody [NBP2-38166] - Analysis in human cell lines A-431 and HEK293 using anti-KRT13 antibody. Corresponding KRT13 RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Cytokeratin 13 Antibody [NBP2-38166] - Immunofluorescent staining of human cell line A-431 shows localization to intermediate filaments. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Cytokeratin 13 Antibody [NBP2-38166] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Cytokeratin, pan
Antibody (AE1 + AE3)
NBP2-29429
Immunocytochemistry/Immunofluorescence: Cytokeratin, pan Antibody (AE1 + AE3) [NBP2-29429] - MCF-7 cells stained with Biotin conjugated version of pan Cytokeratin antibody and SAv-A488. A) SAv-A488 only at a dilution of 1:500, B) pan CK at a dilution of 1:200, C) pan CK at a dilution of 1:400, D) pan CK at a dilution of 1:800. Image from verified customer review.
Immunohistochemistry-Paraffin: Cytokeratin, pan Antibody (AE1 + AE3) [NBP2-29429] - Pan Cytokeratin was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using 1.7 ug/mL of mouse anti-pan Cytokeratin monoclonal (NBP2-29429, Novus Biologicals) for 1 hour at room temperature followed by anti-mouse IgG VisUCyte HRP polymer(VC001). Tissue was stained using DAB (brown) and counterstained with hematoxylin (blue).
Flow (Intracellular): Cytokeratin, pan Antibody (AE1 + AE3) [NBP2-29429] - An intracellular stain was performed on HeLa cells with pan Cytokeratin Antibody (AE1 + AE3) NBP2-33200R (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 10 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Dylight 550.
(10 Publications)
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
Cytokeratin 5
Antibody (2C2)
NBP2-22194
Western Blot: Cytokeratin 5 Antibody (2C2) [NBP2-22194] - Western blot analysis using Cytokeratin 5 mouse mAb against A431 (1), MCF-7 (2), HeLa (3), HepG2 (4), 3T3-L1 (5), and COS-7 (6) cell lysate.
Immunocytochemistry/Immunofluorescence: Cytokeratin 5 Antibody (2C2) [NBP2-22194] - Immunofluorescence analysis of HeLa cells. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: Cytokeratin 5 Antibody (2C2) [NBP2-22194] - Immunohistochemical analysis of paraffin-embedded stomach cancer tissues using Cytokeratin 5 mouse mAb with DAB staining.
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Cytokeratin 14
Antibody (SPM263)
NBP2-34355
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (SPM263) [NBP2-34355] - Formalin-paraffin prostate (20X) stained with Cytokeratin 14 MAb (SPM263).
Flow (Intracellular): Cytokeratin 14 Antibody (SPM263) [NBP2-34355] - An intracellular stain was performed on HeLa cells with Cytokeratin 14 Antibody (SPM263) NBP2-34403AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647. Image from the Alexa Fluor 647 version of this antibody.
Immunohistochemistry-Paraffin: Cytokeratin 14 Antibody (SPM263) [NBP2-34355] - Formalin-paraffin prostate (10X) stained with Cytokeratin 14 MAb (SPM263).
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
Kv6.1 Antibody
NBP1-81572
Western Blot: Kv6.1 Antibody [NBP1-81572] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)
Immunocytochemistry/Immunofluorescence: Kv6.1 Antibody [NBP1-81572] - Immunofluorescent staining of human cell line U-2 OS shows localization to vesicles.
Immunohistochemistry-Paraffin: Kv6.1 Antibody [NBP1-81572] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neuronal cells.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Cytokeratin 3/2p
Antibody (2Q1040)
NBP2-34844
Cytokeratin 3/2p Antibody (2Q1040)
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
Cytokeratin 8
Antibody
NBP2-16094
Western Blot: Cytokeratin 8 Antibody [NBP2-16094] - Wild-type (WT) and Cytokeratin 8 knockout (KO) HeLa cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with Cytokeratin 8 antibody. HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: Cytokeratin 8 Antibody [NBP2-16094] - HeLa cells were fixed in iced-cold MeOH for 5 min. Green: KRT8 protein stained by Cytokeratin 8 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: Cytokeratin 8 Antibody [NBP2-16094] - Immunohistochemical analysis of paraffin-embedded Gastric ca, using antibody at 1:500 dilution.
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Cytokeratin 19
Antibody
NBP1-78278
Western Blot: Cytokeratin 19 Antibody [NBP1-78278] - Analysis of Cytokeratin 19 in MCF7 lysate.
Immunocytochemistry/Immunofluorescence: Cytokeratin 19 Antibody [NBP1-78278] - Tested at 1:25 in MCF7 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: Cytokeratin 19 Antibody [NBP1-78278] - Analysis of Cytokeratin 19 in human kidney carcinoma using DAB with hematoxylin counterstain.
(2 Reviews)
(2 Publications)
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Cytokeratin 10
Antibody (3C2F5)
NBP2-61736
Western Blot: Cytokeratin 10 Antibody (3C2F5) [NBP2-61736] - Analysis using KRT10 mAb against HEK293 (1) and KRT10 (AA: 345-454)-hIgGFc transfected HEK293 (2) cell lysate.
Immunohistochemistry: Cytokeratin 10 Antibody (3C2F5) [NBP2-61736] - Analysis of paraffin-embedded esophageal cancer tissues using KRT10 mouse mAb with DAB staining.
Flow Cytometry: Cytokeratin 10 Antibody (3C2F5) [NBP2-61736] - Analysis of Hela cells using KRT10 mouse mAb (green) and negative control (red).
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, IHC
Lipoprotein a
Antibody (4H1)
NBP2-37477
Western Blot: Lipoprotein a Antibody (4H1) [NBP2-37477] - Western blot analysis using LPA mAb against human LPA recombinant protein. (Expected MW is 34.1 kDa)
Immunocytochemistry/Immunofluorescence: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunofluorescence analysis of HepG2 cells using LPA mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry: Lipoprotein a Antibody (4H1) [NBP2-37477] - Immunohistochemical analysis of paraffin-embedded rectum cancer tissues using LPA mouse mAb with DAB staining.
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
KCNN3 Antibody
NBP2-14144
Immunohistochemistry: KCNN3 Antibody [NBP2-14144] - Staining of human urinary bladder shows moderate cytoplasmic and membranous positivity in urothelial cells.
Species: Hu
Applications: IHC, IHC-P
Plasminogen
Antibody
NB600-930
Western Blot: Plasminogen Antibody [NB600-930] - Lane 1: Plasminogen. Lane 2: None. Load: 50 ng per lane. Primary antibody: Plasminogen primary antibody at 1:1,000 overnight at 4C. Secondary antibody: Peroxidase goat secondary antibody at 1:40,000 for 60 min at RT. Blocking: incubated with blocking buffer for 30 min at RT. Predicted/Observed size: 91 kDa, 91 kDa for Plasminogen. Other band(s): None.
Western Blot: Plasminogen Antibody [NB600-930] - Detection of Plasminogen under reducing (R) and non-reducing (NR) conditions. Reduced samples of purified target proteins contained 4% BME and were boiled for 5 minutes. Samples of 1ug of protein per lane were run by SDS-PAGE. Protein was transferred to nitrocellulose and probed with 1:3000 dilution of primary antibody. Detection shown was using Dylight 649 conjugated Donkey anti goat 1 hr RT.
(2 Reviews)
(8 Publications)
Species: Hu, Ba
Applications: WB, ELISA
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot: HIST1H4F Overexpression Lysate (Adult Normal) [NBP2-07996] Left-Empty vector transfected control cell lysate (HEK293 cell lysate); Right -Over-expression Lysate for HIST1H4F.
Species: Hu
H4/n Antibody
(3E7D9)
NBP2-52487
Immunohistochemistry: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of paraffin-embedded esophageal cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Immunohistochemistry: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of paraffin-embedded colon cancer tissues using HIST2H4A(20Me) mouse mAb with DAB staining.
Immunofluorescence: H4/n Antibody (3E7D9) [NBP2-52487] - Analysis of HeLa cells. Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor- 555 phalloidin.
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
Choline kinase
alpha Antibody
NBP1-85630
Western Blot: Choline kinase alpha Antibody [NBP1-85630] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-CHKA antibody. Corresponding CHKA RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: Choline kinase alpha Antibody [NBP1-85630] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferous ducts.
Species: Hu
Applications: WB, IHC, IHC-P
Choline Kinase
beta Antibody
NBP1-85632
Immunocytochemistry/Immunofluorescence: Choline Kinase beta Antibody [NBP1-85632] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Choline Kinase beta Antibody [NBP1-85632] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HOXB2 Antibody
NBP2-56905
Western Blot: HOXB2 Antibody [NBP2-56905] - Western blot analysis in human cell line RT-4.
Immunocytochemistry/Immunofluorescence: HOXB2 Antibody [NBP2-56905] - Staining of human cell line HEK 293 shows localization to nucleus.
Species: Hu
Applications: WB, ICC/IF
Cytokeratin 7
Antibody
NBP1-88080
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: Cytokeratin 7 Antibody [NBP1-88080] - Staining in human placenta and skeletal muscle tissues. Corresponding KRT7 RNA-seq data are presented for the same tissues.
Western Blot: Cytokeratin 7 Antibody [NBP1-88080] - Analysis in human cell line SiHa.
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Recombinant Human
Cytokeratin 4 Protein
H00003851-Q01
Recombinant Human Cytokeratin 4 Protein
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01) (0)

There are no publications for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01) (0)

There are no reviews for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

Discover related pathways, diseases and genes to Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

Discover more about diseases related to Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01).
 

Pathways for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

View related products by pathway.

PTMs for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

Learn more about PTMs related to Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01).

Blogs on Cytokeratin 4

There are no specific blogs for Cytokeratin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

SDS-Page: Cytokeratin 4 Recombinant Protein [H00003851-P01]
Recombinant Human Cytokeratin 4 Protein
H00003851-P01-10ug
Western Blot: Histone H3 Antibody [NB500-171] - Analysis of HeLa, COS, C6, and K562 cell lysate using histone H3 antibody [NB500-171] antibody at 1:100.
Histone H3 Antibody
NB500-171
Immunocytochemistry/Immunofluorescence: Cytokeratin 4 Antibody (SN74-03) [NBP2-67706] - Staining Cytokeratin 4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Cytokeratin 4 Antibody (SN74-03)
NBP2-67706
Immunocytochemistry/Immunofluorescence: Cytokeratin, pan Antibody (AE1 + AE3) [NBP2-29429] - MCF-7 cells stained with Biotin conjugated version of pan Cytokeratin antibody and SAv-A488. A) SAv-A488 only at a dilution of 1:500, B) pan CK at a dilution of 1:200, C) pan CK at a dilution of 1:400, D) pan CK at a dilution of 1:800. Image from verified customer review.
Cytokeratin, pan Antibody (AE1 + AE3)
NBP2-29429

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytokeratin 4 Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol KRT4