Recombinant Human Cytokeratin 4 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Cytokeratin 4 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 194-300 of Human Cytokeratin 4

Source: Wheat Germ

Amino Acid Sequence: SSKNLEPLFETYLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTH

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
KRT4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
37.51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytokeratin 4 Protein

  • CK4
  • CK-4
  • CYK4cytokeratin-4
  • Cytokeratin-4
  • FLJ31692
  • K4cytokeratin 4
  • keratin 4
  • keratin, type II cytoskeletal 4
  • Keratin-4
  • Type-II keratin Kb4

Background

KRT4 - keratin 4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-30141
Species: Hu, Mu, Rt, Po, Ce, Dr, In, Ma, Ye
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
NB110-56916
Species: Hu
Applications: Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-81572
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-61736
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, IHC
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-14144
Species: Hu
Applications: IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-56905
Species: Hu
Applications: WB, ICC/IF
NBP1-88080
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
H00003851-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01) (0)

There are no publications for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01) (0)

There are no reviews for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

Discover related pathways, diseases and genes to Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

Discover more about diseases related to Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01).
 

Pathways for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

View related products by pathway.

PTMs for Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01)

Learn more about PTMs related to Cytokeratin 4 Partial Recombinant Protein (H00003851-Q01).

Blogs on Cytokeratin 4

There are no specific blogs for Cytokeratin 4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytokeratin 4 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT4