Cytokeratin 19 Antibody

Western Blot: Cytokeratin 19 Antibody [NBP1-53204] - Antibody Titration: 0.2-1 ug/ml ELISA Titer: 1:62500 Positive Control: Human Lung

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-53204] - Human Skin tissue, 5 ug/ml.

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-53204] - Placenta tissue 5ug/ml

Immunohistochemistry-Paraffin: Cytokeratin 19 Antibody [NBP1-53204] - Human Bileduct Tissue, antibody concentration 5 ug/ml.

Product Discontinued

Cytokeratin 19 Antibody Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to KRT19(keratin 19) The peptide sequence was selected from the N terminal of KRT19. Peptide sequence TSYSYRQSSATSSFGGLGGGSVRFGPGVAFRAPSIHGGSGGRGVSVSSAR. The peptide sequence for this immunogen was taken from within the described region.
• Marker: Epithelial Cell Marker
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KRT19
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Cytokeratin 19 Antibody

• 40-kDa keratin intermediate filament
• CK19
• CK-19
• Cytokeratin 19
• EndoC
• K19
• K1CS
• keratin 19
• keratin, type I cytoskeletal 19
• keratin, type I, 40-kd
• keratin-19
• Krt19
• MGC15366

Background

KRT19 is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis.The protein encoded by this gene is a member of the keratin family. The keratins are intermediate filament proteins responsible for the structural integrity of epithelial cells and are subdivided into cytokeratins and hair keratins. The type I cytokeratins consist of acidic proteins which are arranged in pairs of heterotypic keratin chains. Unlike its related family members, this smallest known acidic cytokeratin is not paired with a basic cytokeratin in epithelial cells. It is specifically expressed in the periderm, the transiently superficial layer that envelopes the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Cytokeratin 19 Antibody (NBP1-53204)(1)

Publication using NBP1-53204

• Pednekar KP, Heinrich MA, van Baarlen J, Prakash J Novel 3D tissues Mimicking the Fibrotic Stroma in Pancreatic Cancer to Study Cellular Interactions and Stroma-Modulating Therapeutics Cancers 2021-10-06 [PMID: 34638490] (IHC-P, Human)

FAQs for Cytokeratin 19 Antibody (NBP1-53204). (Showing 1 - 1 of 1 FAQ).

1. Just wanted to know what are the best fixing conditions to fix culture cells to detect ck19 with the NBP1-53204 antibody via immunofluorescence?
   • For our product NBP1-53204, we have not yet tested this antibody with staining in ICC. For our detection of the protein in IHC with paraffin embedded tissue sections, we fixed the tissues with 4% paraformaldehyde. If you do wish to try this product in ICC with your cells, you would be qualified for our Innovator's Reward program. Our Innovator's Reward program was created to allow researchers the opportunity to try our primary antibodies in an untested species or application, without the financial risk of failure. To participate you simply submit an online review detailing your positive or negative results. In return, you receive a discount voucher for 100% of the purchase price of the reviewed product. Reviews may also be submitted by emailing Innovators Reward.

Bioinformatics

• Gene Symbol: KRT19
• Uniprot:
  • P08727()