Recombinant Human Cytokeratin 1 Protein

Images

 
SDS-Page: Recombinant Human Cytokeratin 1 Protein [H00003848-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cytokeratin 1 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 387 - 496 of Human KRT1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:HGDSVRNSKIEISELNRVIQRLRSEIDNVKKQISNLQQSISDAEQRGENALKDAKNKLNDLEDALQQAKEDLARLLRDYQELMNTKLALDLEIATYRTLLEGEESRMSGE

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
KRT1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytokeratin 1 Protein

  • CK1
  • CK-1
  • cytokeratin 1
  • Cytokeratin-1
  • cytokeratin-1,67 kDa cytokeratin
  • EHK
  • EHK1
  • epidermolytic hyperkeratosis 1
  • EPPK
  • Hair alpha protein
  • K1
  • keratin 1
  • keratin, type II cytoskeletal 1
  • Keratin-1
  • KRT1A
  • KRTA
  • NEPPK
  • Type-II keratin Kb1

Background

KRT1 - keratin 1 (epidermolytic hyperkeratosis)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-34270
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-22194
Species: Hu, Mu, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34844
Species: Hu, Mu, Bv, Rb
Applications: WB, IHC-Fr, IHC-P
H00003851-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-38166
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45538
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85632
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-687
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16094
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55459
Species: Hu
Applications: ICC/IF
NBP2-12900
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01) (0)

There are no publications for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01) (0)

There are no reviews for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytokeratin 1 Products

Bioinformatics Tool for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01)

Discover related pathways, diseases and genes to Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01)

Discover more about diseases related to Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01).
 

Pathways for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01)

View related products by pathway.

PTMs for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01)

Learn more about PTMs related to Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01).
 

Research Areas for Cytokeratin 1 Partial Recombinant Protein (H00003848-Q01)

Find related products by research area.

Blogs on Cytokeratin 1

There are no specific blogs for Cytokeratin 1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Albumin Antibody
NB600-41532

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytokeratin 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol KRT1