Cytochrome P450 4A Antibody

Images

 
Western Blot: Cytochrome P450 4A Antibody [H00001579-B01P] - Analysis of CYP4A11 expression in transfected 293T cell line by CYP4A11 polyclonal antibody. Lane 1: CYP4A11 transfected lysate(23.76 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Cytochrome P450 4A Antibody Summary

Immunogen
CYP4A11 (AAH22851, 1 a.a. - 215 a.a.) full-length human protein. MSVSVLSPSRLLGDVSGILQAASLLILLLLLIKAVQLYLHRQWLLKALQQSPCPPSHWLFGHIQELQQDQELQRIQKWVETFPSACPHWLWGGKVRVQLYDPDYMKVILGRSDPKSHGSYRFLAPWIGYGLLLLNGQTWFQHRRMLTPAFHYDILKPYVGLMADSVRVMLDKWEELLGQDSPLEVFQHVSLMTLDTIMKCAFRHWQRAQHSRHLP
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
CYP4A11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome P450 4A Antibody

  • 20-HETE synthase
  • CP4Y
  • CYP4A2
  • cytochrome P450 4A11
  • cytochrome P450, family 4, subfamily A, polypeptide 11
  • cytochrome P450, subfamily IVA, polypeptide 11
  • cytochrome P-450HK-omega
  • cytochrome P450HL-omega
  • fatty acid omega-hydroxylase
  • lauric acid omega-hydroxylase
  • P450HL-omega

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-69678
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80495
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for Cytochrome P450 4A Antibody (H00001579-B01P) (0)

There are no publications for Cytochrome P450 4A Antibody (H00001579-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 4A Antibody (H00001579-B01P) (0)

There are no reviews for Cytochrome P450 4A Antibody (H00001579-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 4A Antibody (H00001579-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 4A Products

Bioinformatics Tool for Cytochrome P450 4A Antibody (H00001579-B01P)

Discover related pathways, diseases and genes to Cytochrome P450 4A Antibody (H00001579-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 4A Antibody (H00001579-B01P)

Discover more about diseases related to Cytochrome P450 4A Antibody (H00001579-B01P).
 

Pathways for Cytochrome P450 4A Antibody (H00001579-B01P)

View related products by pathway.

PTMs for Cytochrome P450 4A Antibody (H00001579-B01P)

Learn more about PTMs related to Cytochrome P450 4A Antibody (H00001579-B01P).
 

Research Areas for Cytochrome P450 4A Antibody (H00001579-B01P)

Find related products by research area.

Blogs on Cytochrome P450 4A

There are no specific blogs for Cytochrome P450 4A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 4A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4A11