Recombinant Human Cytochrome P450 2C18 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Cytochrome P450 2C18 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-490 of Human CYP2C18 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MDPAVALVLCLSCLFLLSLWRQSSGRGRLPSGPTPLPIIGNILQLDVKDMSKSLTNFSKVYGPVFTVYFGLKPIVVLHGYEAVKEALIDHGEEFSGRGSFPVAEKVNKGLGILFSNGKRWKEIRRFCLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTNASPCDPTFILGCAPCNVICSVIFHDRFDYKDQRFLNLMEKFNENLRILSSPWIQVCNNFPALIDYLPGSHNKIAENFAYIKSYVLERIKEHQESLDMNSARDFIDCFLIKMEQEKHNQQSEFTVESLIATVTDMFGAGTETTSTTLRYGLLLLLKYPEVTAKVQEEIECVVGRNRSPCMQDRSHMPYTDAVVHEIQRYIDLLPTNLPHAVTCDVKFKNYLIPKGTTIITSLTSVLHNDKEFPNPEMFDPGHFLDKSGNFKKSDYFMPFSAGKRMCMGEGLARMELFLFLTTILQNFNLKSQVDPKDIDITPIANAFGRVPPLYQLCFIPV

Protein/Peptide Type
Recombinant Protein
Gene
CYP2C18

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytochrome P450 2C18 Protein

  • (S)-mephenytoin hydroxylase associated cytochrome P450
  • CPCI
  • CYP2C
  • CYP2C17
  • CYPIIC18
  • cytochrome P450 2C18
  • cytochrome P450, family 2, subfamily C, polypeptide 18
  • cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 17
  • cytochrome P450, subfamily IIC (mephenytoin 4-hydroxylase), polypeptide 18
  • Cytochrome P450-6b/29c
  • DKFZp686I24235
  • EC 1.14.14.1
  • flavoprotein-linked monooxygenase
  • microsomal monooxygenase
  • P450-6B/29C
  • P450IIC17
  • unspecific monooxygenase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum but its specific substrate has not yet been determined. The gene is located within a cluster of cytochrome P450 genes on chromosome 10q24. An additional gene, CYP2C17, was once thought to exist; however, CYP2C17 is now considered an artefact based on a chimera of CYP2C18 and CYP2C19. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
H00003347-M01
Species: Hu
Applications: ELISA, ICC/IF
NBP2-33467
Species: Hu
Applications: IHC, IHC-P
NBP1-62682
Species: Hu
Applications: WB

Publications for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01) (0)

There are no publications for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01) (0)

There are no reviews for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytochrome P450 2C18 Products

Bioinformatics Tool for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01)

Discover related pathways, diseases and genes to Cytochrome P450 2C18 Recombinant Protein (H00001562-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01)

Discover more about diseases related to Cytochrome P450 2C18 Recombinant Protein (H00001562-P01).
 

Pathways for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01)

View related products by pathway.

PTMs for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01)

Learn more about PTMs related to Cytochrome P450 2C18 Recombinant Protein (H00001562-P01).
 

Research Areas for Cytochrome P450 2C18 Recombinant Protein (H00001562-P01)

Find related products by research area.

Blogs on Cytochrome P450 2C18

There are no specific blogs for Cytochrome P450 2C18, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytochrome P450 2C18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2C18