Cytochrome P450 26B1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Cytochrome P450 26B1 Antibody [NBP1-87371] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol.
Immunohistochemistry-Paraffin: Cytochrome P450 26B1 Antibody [NBP1-87371] - Staining of human liver shows cytoplasmic and membranous positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Cytochrome P450 26B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQARQILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYATTASASTSLIM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP26B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
Cytochrome P450 26B1 Protein (NBP1-87371PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cytochrome P450 26B1 Antibody

  • CYP26A2
  • Cytochrome P450 26A2
  • cytochrome P450 26B1
  • cytochrome P450 CYP26B1 variant 2
  • Cytochrome P450 retinoic acid-inactivating 2
  • cytochrome P450 retinoid metabolizing protein
  • cytochrome P450, family 26, subfamily B, polypeptide 1
  • Cytochrome P450RAI-2
  • DKFZp686G0638
  • EC 1.14
  • MGC129613
  • P450RAI2
  • P450RAI-2
  • Retinoic acid-metabolizing cytochrome

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-50196
Species: Hu, Mu, Rt
Applications: WB, IHC
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NBP2-29997
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
423-F8/CF
Species: Hu, Mu
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NBP2-50444
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-00637
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
355-BM/CF
Species: Hu, Mu, Rt
NBP1-76917
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for Cytochrome P450 26B1 Antibody (NBP1-87371) (0)

There are no publications for Cytochrome P450 26B1 Antibody (NBP1-87371).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome P450 26B1 Antibody (NBP1-87371) (0)

There are no reviews for Cytochrome P450 26B1 Antibody (NBP1-87371). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Cytochrome P450 26B1 Antibody (NBP1-87371) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cytochrome P450 26B1 Products

Bioinformatics Tool for Cytochrome P450 26B1 Antibody (NBP1-87371)

Discover related pathways, diseases and genes to Cytochrome P450 26B1 Antibody (NBP1-87371). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome P450 26B1 Antibody (NBP1-87371)

Discover more about diseases related to Cytochrome P450 26B1 Antibody (NBP1-87371).
 

Pathways for Cytochrome P450 26B1 Antibody (NBP1-87371)

View related products by pathway.

PTMs for Cytochrome P450 26B1 Antibody (NBP1-87371)

Learn more about PTMs related to Cytochrome P450 26B1 Antibody (NBP1-87371).

Blogs on Cytochrome P450 26B1

There are no specific blogs for Cytochrome P450 26B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Cytochrome P450 26B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP26B1
Entrez
Uniprot