Cytochrome P450 26B1 Antibody (1H6) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Cytochrome P450 26B1 Antibody (1H6) - Azide and BSA Free (H00056603-M01) is a monoclonal antibody validated for use in WB and ELISA. Anti-Cytochrome P450 26B1 Antibody: Cited in 6 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
CYP26B1 (NP_063938, 131 a.a. ~ 230 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAINVYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPF |
| Specificity |
CYP26B1 - cytochrome P450, family 26, subfamily B, polypeptide 1 |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
CYP26B1 |
| Purity |
IgG purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Publications |
|
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
IgG purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Cytochrome P450 26B1 Antibody (1H6) - Azide and BSA Free
Background
This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases that catalyze many reactions involved in drug metabolism and the synthesis of cholesterol, steroids and other lipids. The enzyme encoded by this gene is involved in the specific inactivation of all-trans-retinoic acid to hydroxylated forms, such as 4-oxo-, 4-OH-, and 18-OH-all-trans-retinoic acid.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, KO, WB
Species: Hu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Species: Hu, Mu
Applications: BA
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm
Applications: WB, ELISA
Publications for Cytochrome P450 26B1 Antibody (H00056603-M01)(6)
Showing Publications 1 -
6 of 6.
| Publications using H00056603-M01 |
Applications |
Species |
| Chen PH, Lee KW, Hsu CC et al. Expression of a Splice Variant of CYP26B1 in Betel Quid-Related Oral Cancer. ScientificWorldJournal. 2014-07-07 [PMID: 25114974] |
|
|
| Elmabsout AA, Kumawat A, Saenz-Mendez P et al. Cloning and Functional Studies of a Splice Variant of CYP26B1 Expressed in Vascular Cells. PLoS One. 2012-05-29 [PMID: 22666329] |
|
|
| Topletz AR, Thatcher JE, Zelter A et al. Comparison of the function and expression of CYP26A1 and CYP26B1, the two retinoic acid hydroxylases. Biochem Pharmacol. 2012-01-01 [PMID: 22020119] |
|
|
| Chen PH, Lee KW, Chen CH et al. CYP26B1 is a novel candidate gene for betel quid-related oral squamous cell carcinoma. Oral Oncol. 2011-06-08 [PMID: 21641851] |
|
|
| Pavez Lorie E, Li H, Vahlquist A et al. The involvement of cytochrome p450 (CYP) 26 in the retinoic acid metabolism of human epidermal keratinocytes. Biochim Biophys Acta 1791(3):220-8. 2009-03-01 [PMID: 19171200] |
|
|
| Thom SR, Bhopale VM, Mancini DJ, Milovanova TN. Actin S-Nitrosylation Inhibits Neutrophil {beta}2 Integrin Function. J Biol Chem. 2008-04-18 [PMID: 18283105] |
|
|
Reviews for Cytochrome P450 26B1 Antibody (H00056603-M01) (0)
There are no reviews for Cytochrome P450 26B1 Antibody (H00056603-M01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cytochrome P450 26B1 Antibody (H00056603-M01) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytochrome P450 26B1 Products
Research Areas for Cytochrome P450 26B1 Antibody (H00056603-M01)
Find related products by research area.
|
Blogs on Cytochrome P450 26B1