Cytochrome P450 1A1 Antibody [HRP] Summary
Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 200-460 of human Cytochrome P450 1A1 (NP_000490.1).
Sequence: NPYRYVVVSVTNVICAICFGRRYDHNHQELLSLVNLNNNFGEVVGSGNPADFIPILRYLPNPSLNAFKDLNEKFYSFMQKMVKEHYKTFEKGHIRDITDSLIEHCQEKQLDENANVQLSDEKIINIVLDLFG |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
CYP1A1 |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Immunocytochemistry/ Immunofluorescence
- Western Blot
|
Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
Storage |
Store at 4C in the dark. |
Buffer |
PBS |
Preservative |
No Preservative |
Purity |
Affinity purified |
Alternate Names for Cytochrome P450 1A1 Antibody [HRP]
Background
The Cytochrome P450 (P450) superfamily of enzymes is one of three enzyme systems which metabolize the fatty acid arachadonic acid (AA) to regulators of vascular tone. P450 enzymes are monooxygenase enzymes which require several co-factors such as nicotinamide adenine dinucleotide phosphate (NADPH) and P450 reductase. There are over 200 known genes which encode P450s. Epoxygenases are those P450s which metabolize AA to epoxyeicosatrienoic acid (EETs) and omega-hydroxylases are those P450s which produce 19- and 20-hydroxyeicosatetraenoic acids (19- and 20-HETE). As well as fatty acid metabolism, P450s also metabolize many drugs and toxins. Cytochrome P450 3A4 is abundantly expressed in liver and small intestine and is inducible by barbiturates, glucocorticoids and rifampicin.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Species: ET
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt, V-Vi
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ma, Hu, Mu, Pm, Rt, Sh
Applications: ChIP, CHIP-SEQ, GS, IB, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Publications for Cytochrome P450 1A1 Antibody (NBP3-37955H) (0)
There are no publications for Cytochrome P450 1A1 Antibody (NBP3-37955H).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Cytochrome P450 1A1 Antibody (NBP3-37955H) (0)
There are no reviews for Cytochrome P450 1A1 Antibody (NBP3-37955H).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Cytochrome P450 1A1 Antibody (NBP3-37955H) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Cytochrome P450 1A1 Products
Research Areas for Cytochrome P450 1A1 Antibody (NBP3-37955H)
Find related products by research area.
|
Blogs on Cytochrome P450 1A1