Recombinant Human Cytochrome c Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Cytochrome c Peptides and Proteins

Order Details


    • Catalog Number
      H00054205-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Cytochrome c Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-105 of Human CYCS full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
CYCS

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Cytochrome c Protein

  • CYCHCS
  • CYCS
  • Cytochrome c
  • cytochrome c, somatic
  • THC4

Background

CYCS( AAH05299, 1 a.a. - 106 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF820
Species: Hu, Mu
Applications: ICC, IHC, KO, Simple Western, WB
NB100-56098
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56118
Species: Ca, Ma, Hu, Mu, Rt
Applications: Flow-IC, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56116
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NBP2-27335
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, WB
AF860
Species: Hu, Mu
Applications: IP, Simple Western, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-56311
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
MAB868
Species: Hu
Applications: WB
NBP2-43728
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-32550
Species: Hu, Mu, Ze
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP2-59438
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-47534
Species: Hu, Mu
Applications: ELISA, IHC, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB

Publications for Cytochrome c Recombinant Protein (H00054205-P01) (0)

There are no publications for Cytochrome c Recombinant Protein (H00054205-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome c Recombinant Protein (H00054205-P01) (0)

There are no reviews for Cytochrome c Recombinant Protein (H00054205-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome c Recombinant Protein (H00054205-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Cytochrome c Products

Research Areas for Cytochrome c Recombinant Protein (H00054205-P01)

Find related products by research area.

Blogs on Cytochrome c.

Pathway Highlight: Three key factors that contribute to cellular heterogeneity in apoptosis
Have you ever wondered why cells in the same population respond differently to an apoptotic stimulus? Apoptosis, a form of programmed cell death, is vital for the removal of unwanted or damaged cells. As with most cellular processes, too much or to...  Read full blog post.

The use of apoptosis antibodies and controls in cell death research
Apoptosis is a method of programmed cell death that is notably characterized by a morphological change in cellular nuclei and membrane appearance.  Not to be confused with necrosis, apoptosis is a pathway that is induced by a variety of factors tha...  Read full blog post.

Bcl-2 - an antiapoptotic protein with an important role in cancer cell survival
B-cell lymphoma 2 (Bcl-2) protein is an oncogene that normally acts as an apoptotic inhibitor and localizes to the mitochondrial membrane where it prevents the release of cytochrome c. The Bcl-2 protein family consists of over 20 proteins each co...  Read full blog post.

Cytochrome C - a mediator of apoptosis
Cytochrome C is a small heme protein within the inner mitochondrial membrane responsible for carrying electrons within the respiratory transport chain.  Additionally, cytochrome c has also been identified as a player in programmed cell death (apop...  Read full blog post.

Cytochrome C in Apoptosis, Immune Response and Cancer
Cytochrome C is an electron carrier protein that localizes in mitochondrion intermembrane space and has been identified as one of the key signaling molecules of apoptosis or programmed cell death. Suppression of the anti-apoptotic members or activatio...  Read full blog post.

Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS)
Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese...  Read full blog post.

Bax Research Gives New Insight into Oxidative Apoptosis
Bax is a member of the Bcl-2 family; an extensive range of proteins which play key roles in apoptosis, or programmed cell death, by regulating outer mitochondrial membrane permeability. We at Novus Biologicals are one of the leading antibody suppliers...  Read full blog post.

The Role of the Caspase 3 Antibody in Apoptosis Research
The caspases are a group of cysteine protease enzymes essential to apoptosis, inflammation and necrosis. Caspase 3 has been identified as one of the key mediators of apoptosis.Human caspases form three distinct groups: cytokine activators, which are...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Cytochrome c Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYCS