| Description | A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-105 of Human CYCS full-length ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE |
| Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type | Recombinant Protein |
| Gene | CYCS |
| Dilutions |
|
| Application Notes | Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
| Storage | Store at -80C. Avoid freeze-thaw cycles. |
Research Areas for Cytochrome c Recombinant Protein (H00054205-P01)Find related products by research area.
|
|
Pathway Highlight: Three key factors that contribute to cellular heterogeneity in apoptosis Have you ever wondered why cells in the same population respond differently to an apoptotic stimulus? Apoptosis, a form of programmed cell death, is vital for the removal of unwanted or damaged cells. As with most cellular processes, too much or to... Read full blog post. |
|
The use of apoptosis antibodies and controls in cell death research Apoptosis is a method of programmed cell death that is notably characterized by a morphological change in cellular nuclei and membrane appearance. Not to be confused with necrosis, apoptosis is a pathway that is induced by a variety of factors tha... Read full blog post. |
|
Bcl-2 - an antiapoptotic protein with an important role in cancer cell survival B-cell lymphoma 2 (Bcl-2) protein is an oncogene that normally acts as an apoptotic inhibitor and localizes to the mitochondrial membrane where it prevents the release of cytochrome c. The Bcl-2 protein family consists of over 20 proteins each co... Read full blog post. |
|
Cytochrome C - a mediator of apoptosis Cytochrome C is a small heme protein within the inner mitochondrial membrane responsible for carrying electrons within the respiratory transport chain. Additionally, cytochrome c has also been identified as a player in programmed cell death (apop... Read full blog post. |
|
Cytochrome C in Apoptosis, Immune Response and Cancer Cytochrome C is an electron carrier protein that localizes in mitochondrion intermembrane space and has been identified as one of the key signaling molecules of apoptosis or programmed cell death. Suppression of the anti-apoptotic members or activatio... Read full blog post. |
|
Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS) Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese... Read full blog post. |
|
Bax Research Gives New Insight into Oxidative Apoptosis Bax is a member of the Bcl-2 family; an extensive range of proteins which play key roles in apoptosis, or programmed cell death, by regulating outer mitochondrial membrane permeability. We at Novus Biologicals are one of the leading antibody suppliers... Read full blog post. |
|
The Role of the Caspase 3 Antibody in Apoptosis Research The caspases are a group of cysteine protease enzymes essential to apoptosis, inflammation and necrosis. Caspase 3 has been identified as one of the key mediators of apoptosis.Human caspases form three distinct groups: cytokine activators, which are... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CYCS |