Cytochrome C Oxidase subunit 6c Antibody (S51)


Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human small Intestine. Antibody concentration more
ELISA: Cytochrome C Oxidase subunit 6c Antibody (S51) [H00001345-M03] - Detection limit for recombinant GST tagged COX6C is approximately 1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P

Order Details

Cytochrome C Oxidase subunit 6c Antibody (S51) Summary

COX6C (AAH00187, 1 a.a. - 75 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
COX6C - cytochrome c oxidase subunit VIc
IgG1 Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome C Oxidase subunit 6c Antibody (S51)

  • Cytochrome c oxidase polypeptide VIc
  • cytochrome c oxidase subunit 6C
  • cytochrome c oxidase subunit VIc preprotein
  • cytochrome c oxidase subunit VIc


Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ICC
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Dr, I, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03) (0)

There are no publications for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03) (0)

There are no reviews for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Cytochrome C Oxidase subunit 6c Products

Bioinformatics Tool for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03)

Discover related pathways, diseases and genes to Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03)

Discover more about diseases related to Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03).

Pathways for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03)

View related products by pathway.

PTMs for Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03)

Learn more about PTMs related to Cytochrome C Oxidase subunit 6c Antibody (H00001345-M03).

Blogs on Cytochrome C Oxidase subunit 6c

There are no specific blogs for Cytochrome C Oxidase subunit 6c, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Cytochrome C Oxidase subunit 6c Antibody (S51) and receive a gift card or discount.


Gene Symbol COX6C