Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) - Azide and BSA Free

Immunocytochemistry/Immunofluorescence: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01] - Analysis of monoclonal antibody to COX6C on HeLa cell . Antibody concentration 10 ug/ml.

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01] - Analysis of monoclonal antibody to COX6C on formalin-fixed paraffin-embedded human kidney. Antibody concentration 3 ug/ml.

Immunohistochemistry-Paraffin: Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) [H00001345-M01] - Immunoperoxidase of monoclonal antibody to COX6C ( Cat # H00001345-M01 ) on formalin-fixed paraffin-embedded human thyroid nodular goiter tissue.

• Reactivity: Hu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 4G4-2A8
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: COX6C (AAH00187, 1 a.a. ~ 75 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAPEVLPKPRMRGLLARRLRNHMAVAFVLSLGVAALYKFRVADQRKKAYADFYRNYDVMKDFEEMRKAGIFQSVK
• Specificity: COX6C - cytochrome c oxidase subunit VIc
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: COX6C
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Cytochrome C Oxidase subunit 6c Antibody (4G4-2A8) - Azide and BSA Free

• Cytochrome c oxidase polypeptide VIc
• cytochrome c oxidase subunit 6C
• cytochrome c oxidase subunit VIc preprotein
• cytochrome c oxidase subunit VIc

Background

Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIc, which has 77% amino acid sequence identity with mouse COX subunit VIc. This gene is up-regulated in prostate cancer cells. A pseudogene COX6CP1 has been found on chromosomes 16p12.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX6C
• Entrez:
  • 1345(Human)
• OMIM:
  • 124090(Human)
• Uniprot:
  • AAH00187(Human)