CYRPTIC/CFC1 Antibody (2G4)

Sandwich ELISA: CYRPTIC/CFC1 Antibody (2G4) [H00055997-M09] - Detection limit for recombinant GST tagged CFC1 is 0.3 ng/ml as a capture antibody.

Immunoprecipitation: CYRPTIC/CFC1 Antibody (2G4) [H00055997-M09] - Analysis of CFC1 transfected lysate using anti-CFC1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CFC1 rabbit polyclonal antibody.

Product Discontinued

CYRPTIC/CFC1 Antibody (2G4) Summary

• Immunogen: CFC1 (NP_115934.1, 27 a.a. ~ 93 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QREKHNGGREEVTKVATQKHRQSPLNWTSSHFGEVTGSAEGWGPEEPLPYSRAFGEGASARPRCCRN
• Specificity: CFC1 - cripto, FRL-1, cryptic family 1 (2G4)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: CFC1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYRPTIC/CFC1 Antibody (2G4)

• CFC1
• CFC-1
• CFC1B
• cripto, FRL-1, cryptic family 1
• Cryptic family protein 1
• cryptic protein
• Cryptic
• CRYPTICFLJ77897
• HTX2MGC133213

Background

This gene encodes a member of the epidermal growth factor (EGF)- Cripto, Frl-1, and Cryptic (CFC) family. EGF-CFC family member proteins share a variant EGF-like motif, a conserved cysteine-rich domain, and a C-terminal hydrophobic region. These proteins play key roles in intercellular signaling pathways during vertebrate embryogenesis. Mutations in this gene can cause autosomal visceral heterotaxy. This protein is involved in left-right asymmetric morphogenesis during organ development. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: CFC1
• Entrez:
  • 55997(Human)
• Uniprot:
  • NP_115934()