![Western Blot: CYP4V2 Antibody [NBP1-60084] - Jurkat cell lysate, concentration 0.2-1 ug/ml.](http://images.novusbio.com/fullsize/CYP4V2-Antibody-Western-Blot-NBP1-60084-img0002.jpg "Western Blot: CYP4V2 Antibody [NBP1-60084] - Jurkat cell lysate, concentration 0.2-1 ug/ml.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Concentration | 0.5 mg/ml |
| Description | The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution. |
| Immunogen | Synthetic peptides corresponding to CYP4V2(cytochrome P450, family 4, subfamily V, polypeptide 2) The peptide sequence was selected from the middle region of CYP4V2.
Peptide sequence RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI. The peptide sequence for this immunogen was taken from within the described region. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CYP4V2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 0.5 mg/ml |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for CYP4V2 Antibody (NBP1-60084)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Western_Blot_12490.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/Integrin_alpha_2b_MAB7616_Flow_Cytometry_12540.jpg)
![Flow Cytometry Integrin alpha 2b/CD41 Antibody (745201) [Unconjugated]](https://images.novusbio.com/images2/mab7616_human-integrin-alpha-2b-cd41-mab-clone-2530a-flow-cytometry-2462022151722.jpg)
![Immunocytochemistry FABP6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FABP6_AF3880_Immunocytochemistry__Immunofluorescence_20097.jpg)
![Western Blot SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD-1_AF7550_Western_Blot_12344.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/SCD1_AF7550_Knockout_Validated_24050.jpg)
![Knockout Validated SCD-1 Antibody [Unconjugated]](https://images.novusbio.com/images/af7550_human-scd-1-affinity-purified-polyclonal-ab-20820241518560.png)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")