CYP4V2 Antibody


Western Blot: CYP4V2 Antibody [NBP1-60084] - Jurkat cell lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

CYP4V2 Antibody Summary

Synthetic peptides corresponding to CYP4V2(cytochrome P450, family 4, subfamily V, polypeptide 2) The peptide sequence was selected from the middle region of CYP4V2. Peptide sequence RYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP4V2 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP4V2 Antibody

  • BCD
  • CYP4AH1
  • cytochrome P450 4V2
  • cytochrome P450, family 4, subfamily V, polypeptide 2
  • EC 1.14
  • EC
  • FLJ18432
  • MGC43534


CYP4V2 may have a role in fatty acid and steroid metabolism.This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
Species: Hu
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
Species: Hu
Applications: WB, IP, Neut
Species: Hu
Applications: WB, IP, DirELISA
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF

Publications for CYP4V2 Antibody (NBP1-60084) (0)

There are no publications for CYP4V2 Antibody (NBP1-60084).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4V2 Antibody (NBP1-60084) (0)

There are no reviews for CYP4V2 Antibody (NBP1-60084). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4V2 Antibody (NBP1-60084) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional CYP4V2 Products

Bioinformatics Tool for CYP4V2 Antibody (NBP1-60084)

Discover related pathways, diseases and genes to CYP4V2 Antibody (NBP1-60084). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4V2 Antibody (NBP1-60084)

Discover more about diseases related to CYP4V2 Antibody (NBP1-60084).

Pathways for CYP4V2 Antibody (NBP1-60084)

View related products by pathway.

PTMs for CYP4V2 Antibody (NBP1-60084)

Learn more about PTMs related to CYP4V2 Antibody (NBP1-60084).

Blogs on CYP4V2

There are no specific blogs for CYP4V2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CYP4V2 Antibody and receive a gift card or discount.


Gene Symbol CYP4V2