CYP4F12 Antibody

Images

 
Western Blot: CYP4F12 Antibody [NBP1-62384] - Human Placenta lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP4F12 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP4F12(cytochrome P450, family 4, subfamily F, polypeptide 12) The peptide sequence was selected from the middle region of CYP4F12. Peptide sequence DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP4F12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against CYP4F12 and was validated on Western blot.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP4F12 Antibody

  • CYPIVF12
  • cytochrome P450 4F12
  • cytochrome P450, family 4, subfamily F, polypeptide 12
  • cytochrome P450, subfamily IVF, polypeptide 12
  • EC 1.14.14.1
  • F22329_1

Background

CYP4F12 is a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. Tt likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19. Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein likely localizes to the endoplasmic reticulum. When expressed in yeast the enzyme is capable of oxdizing arachidonic acid; however, its physiological function has not been determined. This gene is part of a cluster of cytochrome P450 genes on chromosome 19.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69678
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-86461
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16082
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50212
Species: Hu, Mu, Rt, Dr, Xp
Applications: WB, ELISA, IHC
NBP2-01286
Species: Hu
Applications: WB, IHC, IHC-P
H00001551-B01P
Species: Hu
Applications: WB
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00011283-R01
Species: Hu
NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-16078
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-684
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
H00001109-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-62384
Species: Hu
Applications: WB

Publications for CYP4F12 Antibody (NBP1-62384) (0)

There are no publications for CYP4F12 Antibody (NBP1-62384).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP4F12 Antibody (NBP1-62384) (0)

There are no reviews for CYP4F12 Antibody (NBP1-62384). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP4F12 Antibody (NBP1-62384) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP4F12 Products

Bioinformatics Tool for CYP4F12 Antibody (NBP1-62384)

Discover related pathways, diseases and genes to CYP4F12 Antibody (NBP1-62384). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP4F12 Antibody (NBP1-62384)

Discover more about diseases related to CYP4F12 Antibody (NBP1-62384).
 

Pathways for CYP4F12 Antibody (NBP1-62384)

View related products by pathway.

PTMs for CYP4F12 Antibody (NBP1-62384)

Learn more about PTMs related to CYP4F12 Antibody (NBP1-62384).
 

Research Areas for CYP4F12 Antibody (NBP1-62384)

Find related products by research area.

Blogs on CYP4F12

There are no specific blogs for CYP4F12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP4F12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP4F12
Uniprot