CYP2A7 Antibody

Images

 
Western Blot: CYP2A7 Antibody [NBP1-69675] - Reccomended Titration: 0.2 - 1 ug/ml ELISA Titer: 1:1562500 Positive Control: PANC1 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

CYP2A7 Antibody Summary

Immunogen
Synthetic peptides corresponding to CYP2A7 (cytochrome P450, family 2, subfamily A, polypeptide 7) The peptide sequence was selected from the N terminal of CYP2A7. Peptide sequence MLASGLLLVALLACLTVMVLMSVWQQRKSRGKLPPGPTPLPFIGNYLQLN.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CYP2A7
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against CYP2A7 and was validated on Western blot.
Theoretical MW
56 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for CYP2A7 Antibody

  • CPA7
  • CPAD
  • CYP2A
  • CYPIIA7
  • cytochrome P450 2A7
  • Cytochrome P450 IIA4
  • cytochrome P450, family 2, subfamily A, polypeptide 7
  • cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 7
  • EC 1.14.14.1
  • P450-IIA4

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum; its substrate has not yet been determined. This gene, which produces two transcript variants, is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01437
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, IHC, IHC-P
NBP2-37502
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP2-01800
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-01397
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-85488
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91818
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33467
Species: Hu
Applications: IHC, IHC-P
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP2-02563
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14922
Species: Hu
Applications: WB
NBP2-29917
Species: Hu
Applications: WB, ICC/IF, IHC-P
PP-N4111-00
Species: Hu
Applications: WB, IHC, IP
NBP2-29875
Species: Mu, Rt
Applications: WB
NBP1-69675
Species: Hu
Applications: WB

Publications for CYP2A7 Antibody (NBP1-69675) (0)

There are no publications for CYP2A7 Antibody (NBP1-69675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP2A7 Antibody (NBP1-69675) (0)

There are no reviews for CYP2A7 Antibody (NBP1-69675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP2A7 Antibody (NBP1-69675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CYP2A7 Products

Bioinformatics Tool for CYP2A7 Antibody (NBP1-69675)

Discover related pathways, diseases and genes to CYP2A7 Antibody (NBP1-69675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP2A7 Antibody (NBP1-69675)

Discover more about diseases related to CYP2A7 Antibody (NBP1-69675).
 

Pathways for CYP2A7 Antibody (NBP1-69675)

View related products by pathway.

PTMs for CYP2A7 Antibody (NBP1-69675)

Learn more about PTMs related to CYP2A7 Antibody (NBP1-69675).

Blogs on CYP2A7

There are no specific blogs for CYP2A7, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CYP2A7 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2A7
Uniprot