Recombinant Human CYP2A13 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human CYP2A13 GST (N-Term) Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-494 of Human CYP2A13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MLASGLLLVTLLACLTVMVLMSVWRQRKSRGKLPPGPTPLPFIGNYLQLNTEQMYNSLMKISERYGPVFTIHLGPRRVVVLCGHDAVKEALVDQAEEFSGRGEQATFDWLFKGYGVAFSNGERAKQLRRFSIATLRGFGVGKRGIEERIQEEAGFLIDALRGTHGANIDPTFFLSRTVSNVISSIVFGDRFDYEDKEFLSLLRMMLGSFQFTATSTGQLYEMFSSVMKHLPGPQQQAFKELQGLEDFIAKKVEHNQRTLDPNSPRDFIDSFLIRMQEEEKNPNTEFYLKNLVMTTLNLFFAGTETVSTTLRYGFLLLMKHPEVEAKVHEEIDRVIGKNRQPKFEDRAKMPYTEAVIHEIQRFGDMLPMGLAHRVNKDTKFRDFFLPKGTEVFPMLGSVLRDPRFFSNPRDFNPQHFLDKKGQFKKSDAFVPFSIGKRYCFGEGLARMELFLFFTTIMQNFRFKSPQSPKDIDVSPKHVGFATIPRNYTMSFLPR

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
CYP2A13
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
81.29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP2A13 GST (N-Term) Protein

  • CPAD
  • CYP2A
  • CYPIIA13
  • cytochrome P450 2A13
  • cytochrome P450, family 2, subfamily A, polypeptide 13
  • cytochrome P450, subfamily IIA (phenobarbital-inducible), polypeptide 13
  • EC 1.14.14.1

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This protein localizes to the endoplasmic reticulum. Although its endogenous substrate has not been determined, it is known to metabolize 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone, a major nitrosamine specific to tobacco. This gene is part of a large cluster of cytochrome P450 genes from the CYP2A, CYP2B and CYP2F subfamilies on chromosome 19q. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01437
Species: Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP2-37502
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01800
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-85367
Species: Hu, Mu, Rt, V-Vi
Applications: IHC, IHC-P, WB
H00001556-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-01397
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-02563
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-74398
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67020
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
NBP2-92808
Species: Hu, Mu, Rt
Applications: WB
NBP3-10546
Species: Hu
Applications: WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-92810
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00001549-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-50209
Species: Hu
Applications: ELISA, IHC, WB
NBP2-24722
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
PP-N4111-00
Species: Hu
Applications: IHC, IP, WB
H00001553-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for CYP2A13 Recombinant Protein (H00001553-P01) (0)

There are no publications for CYP2A13 Recombinant Protein (H00001553-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP2A13 Recombinant Protein (H00001553-P01) (0)

There are no reviews for CYP2A13 Recombinant Protein (H00001553-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP2A13 Recombinant Protein (H00001553-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP2A13 Products

Bioinformatics Tool for CYP2A13 Recombinant Protein (H00001553-P01)

Discover related pathways, diseases and genes to CYP2A13 Recombinant Protein (H00001553-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP2A13 Recombinant Protein (H00001553-P01)

Discover more about diseases related to CYP2A13 Recombinant Protein (H00001553-P01).
 

Pathways for CYP2A13 Recombinant Protein (H00001553-P01)

View related products by pathway.

PTMs for CYP2A13 Recombinant Protein (H00001553-P01)

Learn more about PTMs related to CYP2A13 Recombinant Protein (H00001553-P01).

Blogs on CYP2A13

There are no specific blogs for CYP2A13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CYP1B1 Antibody
NBP2-24722

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP2A13 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP2A13