CYP27A1 Antibody

Western Blot: CYP27A1 Antibody [H00001593-B01P] - Analysis of CYP27A1 expression in human liver.

Western Blot: CYP27A1 Antibody [H00001593-B01P] - Analysis of CYP27A1 expression in transfected 293T cell line by CYP27A1 polyclonal antibody. Lane 1: CYP27A1 transfected lysate(58.41 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

CYP27A1 Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: CYP27A17A1 (NP_000775.1, 1 a.a. ~ 531 a.a) full-length human protein. MAALGCARLRWALRGAGRGLCPHGARAKAAIPAALPSDKATGAPGAGPGVRRRQRSLEEIPRLGQLRFFFQLFVQGYALQLHQLQVLYKAKYGPMWMSYLGPQMHVNLASAPLLEQVMRQEGKYPVRNDMELWKEHRDQHDLTYGPFTTEGHHWYQLRQALNQRLLKPAEAALYTDAFNEVIDDFMTRLDQLRAESASGNQVSDMAQLFYYFALEAICYILFEKRIGCLQRSIPEDTVTFVRSIGLMFQNSLYATFLPKWTRPVLPFWKRYLDGWNAIFSFGKKLIDEKLEDMEAQLQAAGPDGIQVSGYLHFLLASGQLSPREAMGSLPELLMAGVDTTSNTLTWALYHLSKDPEIQEALHEEVVGVVPAGQVPQHKDFAHMPLLKAVLKETLRLYPVVPTNSRIIEKEIEVDGFLFPKNTQFVFCHYVVSRDPTAFSEPESFQPHRWLRNSQPATPRIQHPFGSVPFGYGVRACLGRRIAELEMQLLLARLIQKYKVVLAPETGELKSVARIVLVPNKKVGLQFLQRQC
• Specificity: CYP27A1 - cytochrome P450, family 27, subfamily A, polypeptide 1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: CYP27A1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate in WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CYP27A1 Antibody

• 12-alpha-triol 27-hydroxylase
• 7-alpha
• cholestanetriol 26-monooxygenase
• CP27,5-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 27-hydroxylase
• CTX5-beta-cholestane-3-alpha
• CYP27
• CYP275-beta-cholestane-3-alpha, 7-alpha, 12-alpha-triol 26-hydroxylase
• CYP27A1
• Cytochrome P450 27
• cytochrome P450, family 27, subfamily A, polypeptide 1
• cytochrome P450, subfamily XXVIIA (steroid 27-hydroxylase, cerebrotendinousxanthomatosis), polypeptide 1
• Cytochrome P-450C27/25
• EC 1.14.13.15
• EC 1.14.15.15
• sterol 26-hydroxylase, mitochondrial
• Sterol 27-hydroxylase
• Vitamin D(3) 25-hydroxylase

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This mitochondrial protein oxidizes cholesterol intermediates as part of the bile synthesis pathway. Since the conversion of cholesterol to bile acids is the major route for removing cholesterol from the body, this protein is important for overall cholesterol homeostasis. Mutations in this gene cause cerebrotendinous xanthomatosis, a rare autosomal recessive lipid storage disease. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for CYP27A1 Antibody (H00001593-B01P)(1)

Publication using H00001593-B01P

• Dasari B, Prasanthi JR, Marwarha G et al. Cholesterol-Enriched Diet Causes Age-Related Macular Degeneration-Like Pathology in Rabbit retina. BMC Ophthalmol;11(1):22. 2011-08-18 [PMID: 21851605]

Bioinformatics

• Gene Symbol: CYP27A1
• Entrez:
  • 1593(Human)
• Uniprot:
  • NP_000775.1(Human)