Recombinant Human CYP26C1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CYP26C1 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 423 - 522 of Human CYP26C1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SPPEGFDPERFGAAREDSRGASSRFHYIPFGGGARSCLGQELAQAVLQLLAVELVRTARWELATPAFPAMQTVPIVHPVDGLRLFFHPLTPSVAGNGLCL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
CYP26C1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CYP26C1 Protein

  • cytochrome P450 26C1
  • cytochrome P450, family 26, subfamily C, polypeptide 1
  • EC 1.14
  • FLJ45301

Background

This gene encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. This enzyme is involved in the catabolism of all-trans- and 9-cis-retinoic acid, and thus contributes to the regulation of retinoic acid levels in cells and tissues. This gene is adjacent to a related gene on chromosome 10q23.33. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00056603-M01
Species: Hu
Applications: WB, ELISA
NBP1-87158
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP2-15339
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-19117
Species: Hu
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-89649
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-89934
Species: Hu
Applications: WB, IHC, IHC-P
MAB7330
Species: Hu
Applications: CyTOF-ready, ICFlow
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr
NB100-2590
Species: Hu
Applications: IP (-), WB, IHC-P
NBP1-91897
Species: Hu
Applications: WB, IHC, IHC-P
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
H00006241-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP1-76775
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46076
Species: Hu
Applications: WB, IHC
NBP1-85031
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31222
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00340665-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CYP26C1 Partial Recombinant Protein (H00340665-Q01) (0)

There are no publications for CYP26C1 Partial Recombinant Protein (H00340665-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP26C1 Partial Recombinant Protein (H00340665-Q01) (0)

There are no reviews for CYP26C1 Partial Recombinant Protein (H00340665-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CYP26C1 Partial Recombinant Protein (H00340665-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP26C1 Products

Bioinformatics Tool for CYP26C1 Partial Recombinant Protein (H00340665-Q01)

Discover related pathways, diseases and genes to CYP26C1 Partial Recombinant Protein (H00340665-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP26C1 Partial Recombinant Protein (H00340665-Q01)

Discover more about diseases related to CYP26C1 Partial Recombinant Protein (H00340665-Q01).
 

Pathways for CYP26C1 Partial Recombinant Protein (H00340665-Q01)

View related products by pathway.

PTMs for CYP26C1 Partial Recombinant Protein (H00340665-Q01)

Learn more about PTMs related to CYP26C1 Partial Recombinant Protein (H00340665-Q01).

Blogs on CYP26C1

There are no specific blogs for CYP26C1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALDH1A3 Antibody
NBP2-15339
ALDH1A2 Antibody
NBP1-87158

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CYP26C1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP26C1