CYP21A2 Recombinant Protein Antigen

Images

 
There are currently no images for CYP21A2 Protein (NBP2-38698PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CYP21A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CYP21A2.

Source: E.coli

Amino Acid Sequence: LIGGTETTANTLSWAVVFLLHHPEIQQRLQEELDHELGPGASSSRVPYKDRARLPLLNATIAEV

Protein/Peptide Type
Recombinant Protein Antigen
Gene
CYP21A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-38698.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CYP21A2 Recombinant Protein Antigen

  • 21-OHase
  • CA21HCYP21B
  • CAH1
  • CPS1
  • CYP21EC 1.14.99.10
  • Cytochrome P450 21
  • Cytochrome P450 XXI
  • cytochrome P450, family 21, subfamily A, polypeptide 2
  • cytochrome P450, subfamily XXIA (steroid 21-hydroxylase, congenital adrenalhyperplasia), polypeptide 2
  • Cytochrome P-450c21
  • Cytochrome P450-C21
  • Cytochrome P450-C21B
  • EC 1.14.99
  • MGC150536
  • MGC150537
  • P450c21B
  • steroid 21-hydroxylase
  • steroid 21-monooxygenase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-34234
Species: Hu
Applications: ICC/IF, IHC-Fr, IHC-P
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB200-541
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-56518
Species: Hu
Applications: WB
AF6999
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NB110-68136
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-46290
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89312
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for CYP21A2 Protein (NBP2-38698PEP) (0)

There are no publications for CYP21A2 Protein (NBP2-38698PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CYP21A2 Protein (NBP2-38698PEP) (0)

There are no reviews for CYP21A2 Protein (NBP2-38698PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for CYP21A2 Protein (NBP2-38698PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CYP21A2 Products

Bioinformatics Tool for CYP21A2 Protein (NBP2-38698PEP)

Discover related pathways, diseases and genes to CYP21A2 Protein (NBP2-38698PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CYP21A2 Protein (NBP2-38698PEP)

Discover more about diseases related to CYP21A2 Protein (NBP2-38698PEP).
 

Pathways for CYP21A2 Protein (NBP2-38698PEP)

View related products by pathway.

PTMs for CYP21A2 Protein (NBP2-38698PEP)

Learn more about PTMs related to CYP21A2 Protein (NBP2-38698PEP).
 

Research Areas for CYP21A2 Protein (NBP2-38698PEP)

Find related products by research area.

Blogs on CYP21A2

There are no specific blogs for CYP21A2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CYP21A2 Antibody
NBP2-13893
CYP21A2 Antibody
NBP2-13893

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CYP21A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CYP21A2