Cyclin D2 Antibody

Images

 
Western Blot: Cyclin D2 Antibody [NBP2-14460] - Analysis in human cell lines Caco-2 and A-549 using Anti-CCND2 antibody. Corresponding CCND2 RNA-seq data are presented for the same cell lines. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: Cyclin D2 Antibody [NBP2-14460] - Staining of human liver shows very weak cytoplasmic positivity in hepatocytes.
Western Blot: Cyclin D2 Antibody [NBP2-14460] - Analysis in human cell line HDLM-2.
Immunohistochemistry-Paraffin: Cyclin D2 Antibody [NBP2-14460] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Cyclin D2 Antibody [NBP2-14460] - Staining of human kidney shows moderate membranous positivity in cells in tubules.
Immunohistochemistry-Paraffin: Cyclin D2 Antibody [NBP2-14460] - Staining of human cervix, uterine shows moderate membranous positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
       

Orthogonal Strategies

 

Order Details

Cyclin D2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
CCND2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000-1:2500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
Cyclin D2 Protein (NBP2-14460PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP2-14460 in the following applications:

Publications
Read Publications using NBP2-14460.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23227862)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Cyclin D2 Antibody

  • CCND2
  • Cyclin D2
  • G1/S-specific cyclin D2
  • G1/S-specific cyclin-D2
  • KIAK0002
  • MGC102758
  • Vin1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP1-31806
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31308
Species: Hu, Mu, Rt, Bv
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF1555
Species: Hu
Applications: WB
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87262
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56598
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-05767
Species: Hu, Mu, Rt, Ha, Rb
Applications: WB, Flow, IHC-P

Publications for Cyclin D2 Antibody (NBP2-14460)(2)

Review for Cyclin D2 Antibody (NBP2-14460) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: IF.

Reviews using NBP2-14460:
Filter by Applications
IF
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunofluorescence Cyclin D2 NBP2-14460
Enlarge
reviewed by:
Natalie Erdmann
IF Human 11/17/2015
View

Summary

ApplicationImmunofluorescence
Sample Tested8226 (multiple myeloma), U266 (multiple myeloma), LP-1 (multiple myeloma), KMS12 (multiple myeloma), Daudi (Burkitt lymphoma)
SpeciesHuman
LotR59134

Blocking

Blocking Details10% donkey serum in PBS 1 hour at room temperature

Primary Anitbody

Dilution Ratio1/200 1ary antibody diluted in 10% donkey serum/PBS incubated O/N at 4oC.

Secondary Antibody

Secondary DescriptionDonkey F(ab")2 anti-rabbit IgG (H+L) Alexa Fluor 488
Secondary Manufacturer Cat#Jackson 711-546-152
Secondary Concentration1/1000

Details

Detection NotesZeiss AxioImager, FITC filter cube for 300 ms exposure
Fixation DetailsImmersion-fixed in 4% paraformaldehyde 10 minutes, 0.5% Triton X-100 5 minutes permeabilization at room temperature
Wash Description3X 5 minutes PBS after each step

Comments

Comments8226, U266, & LP-1 positive controls, KMS12 & Daudi negative controls.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Cyclin D2 Antibody (NBP2-14460) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Cyclin D2 Products

Bioinformatics Tool for Cyclin D2 Antibody (NBP2-14460)

Discover related pathways, diseases and genes to Cyclin D2 Antibody (NBP2-14460). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Cyclin D2 Antibody (NBP2-14460)

Discover more about diseases related to Cyclin D2 Antibody (NBP2-14460).
 

Pathways for Cyclin D2 Antibody (NBP2-14460)

View related products by pathway.

PTMs for Cyclin D2 Antibody (NBP2-14460)

Learn more about PTMs related to Cyclin D2 Antibody (NBP2-14460).
 

Research Areas for Cyclin D2 Antibody (NBP2-14460)

Find related products by research area.

Blogs on Cyclin D2

There are no specific blogs for Cyclin D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Natalie Erdmann
11/17/2015
Application: IF
Species: Human

Bioinformatics

Gene Symbol CCND2