![Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Staining of 8226, U266, LP-1, KMS12 and Daudi cells. Image submitted by a verified customer review.](http://images.novusbio.com/fullsize/Cyclin-D2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14460-img0006.jpg "Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Staining of 8226, U266, LP-1, KMS12 and Daudi cells. Image submitted by a verified customer review.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit Cyclin D2 Antibody - BSA Free (NBP2-14460) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Cyclin D2 Antibody: Cited in 5 publications. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QEQIEAVLLNSLQQYRQDQRDGSKSEDELDQASTPTDVRGIDL |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CCND2 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Natalie Erdmann |
IF | Human | 11/17/2015 |
Summary
|
Secondary Antibodies |
Isotype Controls |
Research Areas for Cyclin D2 Antibody (NBP2-14460)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CCND2 |
![Immunohistochemistry: Cyclin D2 Antibody [NBP2-14460] - Evaluation of Cyclin D2 expression in RCC samples. Immunohistochemistry staining showed a significant decrease of Cyclin D2 protein expression in 43 paired RCC samples in 40X, 100X, 200X magnification. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0161859), licensed under a CC-BY license.](http://images.novusbio.com/fullsize/Cyclin-D2-Antibody-Immunohistochemistry-NBP2-14460-img0007.jpg "Immunohistochemistry: Cyclin D2 Antibody [NBP2-14460] - Evaluation of Cyclin D2 expression in RCC samples. Immunohistochemistry staining showed a significant decrease of Cyclin D2 protein expression in 43 paired RCC samples in 40X, 100X, 200X magnification. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0161859), licensed under a CC-BY license.")
![Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Cyclin-D2-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-14460-img0005.jpg "Immunocytochemistry/Immunofluorescence: Cyclin D2 Antibody [NBP2-14460] - Immunofluorescent staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.")
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
