CYBB/NOX2 Antibody [DyLight 755] Summary
| Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 101-200 of human CYBB/NOX2 (NP_000388.2).
Sequence: FHKMVAWMIALHSAIHTIAHLFNVEWCVNARVNNSDPYSVALSELGDRQNESYLNFARKRIKNPEGGLYLAVTLLAGITGVVITLCLILIITSSTKTIRRS |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
CYBB |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
|
| Application Notes |
Optimal dilution of this antibody should be experimentally determined. |
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
50mM Sodium Borate |
| Preservative |
0.05% Sodium Azide |
| Purity |
Affinity purified |
Notes
DyLight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.
Alternate Names for CYBB/NOX2 Antibody [DyLight 755]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ba, Hu, Mu, Po
Applications: Flow, ICC/IF, IHC, Â IHC-P, IP, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, Â IHC-P, IP, WB
Species: Bv, Hu, Mu, Po, Pm, Rb, Rt, Sh
Applications: IB, ICC/IF, IHC, IHC-Fr, Â IHC-P, KD, WB
Species: Hu
Applications: ICC/IF, IHC, Â IHC-P
Species: Hu, Mu, Rt
Applications: Flow, IHC, Â IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, Â IHC-P
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, Â IHC-P, WB
Species: Hu, Mu, Po, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, Â IHC-P, In vitro, WB
Species: Hu
Applications: IHC, Â IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, Â IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Publications for CYBB/NOX2 Antibody (NBP3-36716IR) (0)
There are no publications for CYBB/NOX2 Antibody (NBP3-36716IR).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for CYBB/NOX2 Antibody (NBP3-36716IR) (0)
There are no reviews for CYBB/NOX2 Antibody (NBP3-36716IR).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for CYBB/NOX2 Antibody (NBP3-36716IR) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional CYBB/NOX2 Products
Research Areas for CYBB/NOX2 Antibody (NBP3-36716IR)
Find related products by research area.
|
Blogs on CYBB/NOX2