CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11)

Images

 
Sandwich ELISA: CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11) [H00002919-M01] - Detection limit for recombinant GST tagged CXCL1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
7A11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11) Summary

Immunogen
CXCL1 (AAH11976, 36 a.a. ~ 107 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Specificity
CXCL1 - chemokine (C-X-C motif) ligand 1 (melanoma growth stimulating activity, alpha)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
CXCL1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA 1:100-1:2000
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00002919-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11)

  • CINC1
  • CINC-1
  • CXCL1
  • FSP
  • GRO alpha
  • GRO1
  • GROa
  • KC
  • MGSA
  • MGSA-a
  • MGSA-alpha
  • NAP-3
  • SCYB1

Background

Chemokines are a group of small (approximately 8 to 14 kD), mostly basic, structurally related molecules that regulate cell trafficking of various types of leukocytes through interactions with a subset of 7-transmembrane, G protein-coupled receptors. Chemokines also play fundamental roles in the development, homeostasis, and function of the immune system, and they have effects on cells of the central nervous system as well as on endothelial cells involved in angiogenesis or angiostasis. Chemokines are divided into 2 major subfamilies, CXC and CC, based on the arrangement of the first 2 of the 4 conserved cysteine residues; the 2 cysteines are separated by a single amino acid in CXC chemokines and are adjacent in CC chemokines. CXC chemokines are further subdivided into ELR and non-ELR types based on the presence or absence of a glu-leu-arg sequence adjacent and N terminal to the CXC motif.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB208
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, ICFlow, Neut, Simple Western, WB
210-TA
Species: Hu
Applications: BA
DCP00
Species: Hu
Applications: ELISA
D6050
Species: Hu
Applications: ELISA
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
MM200
Species: Mu
Applications: ELISA
DRN00B
Species: Hu
Applications: ELISA
DY443
Species: Mu
Applications: ELISA
MAB331
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut
DY393
Species: Hu
Applications: ELISA
DIP100
Species: Hu
Applications: ELISA
201-LB/CF
Species: Hu
Applications: BA
AF3667
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DY417
Species: Mu
Applications: ELISA
MAB330
Species: Hu
Applications: CyTOF-reported, Flow, IHC, Neut
285-IF
Species: Hu
Applications: BA
H00002919-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01)(1)


Showing Publication 1 - 1 of 1.
Publication using H00002919-M01 Applications Species
Cuff M, Ruzek MC, Voss JW. et al. Biomarkers for Inflammatory Disease and Methods of Using Same United States Patent Application Jan 7 2016

Reviews for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01) (0)

There are no reviews for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional CXCL1/GRO alpha/KC/CINC-1 Products

Bioinformatics Tool for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01)

Discover related pathways, diseases and genes to CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01)

Discover more about diseases related to CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01).
 

Pathways for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01)

View related products by pathway.

PTMs for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01)

Learn more about PTMs related to CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01).
 

Research Areas for CXCL1/GRO alpha/KC/CINC-1 Antibody (H00002919-M01)

Find related products by research area.

Blogs on CXCL1/GRO alpha/KC/CINC-1

There are no specific blogs for CXCL1/GRO alpha/KC/CINC-1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our CXCL1/GRO alpha/KC/CINC-1 Antibody (7A11) and receive a gift card or discount.

Bioinformatics

Gene Symbol CXCL1
Entrez
OMIM
Uniprot