CUZD1 Antibody


Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49561] - Staining in human pancreas and colon tissues using anti-CUZD1 antibody. Corresponding CUZD1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: CUZD1 Antibody [NBP2-49561] - Staining of human colon shows low expression as expected.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

CUZD1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: CKVLICDSSDHQSRCNQGCVSRSKRDISSYKWKTDSIIGPIRLKRDRSASGNSGFQHETHAEETPNQP
Specificity of human CUZD1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
CUZD1 Recombinant Protein Antigen (NBP2-49561PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for CUZD1 Antibody

  • CUB and zona pellucida-like domain-containing protein 1
  • CUB and zona pellucida-like domains 1
  • CUB and ZP domain-containing protein 1
  • ERG-1
  • estrogen regulated gene 1
  • Transmembrane protein UO-44
  • UO-44


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, GP, Ha, Mk, Rb, Sh
Applications: WB, EM, EIA, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for CUZD1 Antibody (NBP2-49561) (0)

There are no publications for CUZD1 Antibody (NBP2-49561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CUZD1 Antibody (NBP2-49561) (0)

There are no reviews for CUZD1 Antibody (NBP2-49561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for CUZD1 Antibody (NBP2-49561) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for CUZD1 Antibody (NBP2-49561)

Discover related pathways, diseases and genes to CUZD1 Antibody (NBP2-49561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CUZD1 Antibody (NBP2-49561)

Discover more about diseases related to CUZD1 Antibody (NBP2-49561).

Pathways for CUZD1 Antibody (NBP2-49561)

View related products by pathway.

Blogs on CUZD1

There are no specific blogs for CUZD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our CUZD1 Antibody and receive a gift card or discount.


Gene Symbol CUZD1