Recombinant Human CTRP6 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CTRP6 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 32 - 278 of Human C1QTNF6 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:LLLFLLMCEIPMVELTFDRAVASGCQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLRGIYFFSLNVHSWNYKETYVHIMHNQKEAVILYAQPSERSIMQSQSVMLDLAYGDRVWVRLFKRQRENAIYSNDFDTYITFSGHLIKAEDD

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
C1QTNF6

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CTRP6 Protein

  • C1q and tumor necrosis factor related protein 6
  • C1qTNF6
  • complement C1q tumor necrosis factor-related protein 6
  • complement-c1q tumor necrosis factor-related protein 6
  • CTRP6
  • CTRP6ZACRP6
  • ZACRP6

Background

C1QTNF6( AAH20551, 32 a.a. - 279 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3145
Species: Hu
Applications: WB
MAB3167
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB3428
Species: Hu
Applications: WB, IHC
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00000712-P01
Species: Hu
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-34167
Species: Hu
Applications: IHC, IHC-P
NBP1-88826
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF7177
Species: Hu
Applications: WB, ICC
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
AF2067
Species: Hu, Po, Ca
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP1-31165
Species: Hu
Applications: WB, IHC, IHC-P
594-ML/CF
Species: Mu

Publications for CTRP6 Recombinant Protein (H00114904-P01) (0)

There are no publications for CTRP6 Recombinant Protein (H00114904-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTRP6 Recombinant Protein (H00114904-P01) (0)

There are no reviews for CTRP6 Recombinant Protein (H00114904-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTRP6 Recombinant Protein (H00114904-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CTRP6 Products

Bioinformatics Tool for CTRP6 Recombinant Protein (H00114904-P01)

Discover related pathways, diseases and genes to CTRP6 Recombinant Protein (H00114904-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTRP6 Recombinant Protein (H00114904-P01)

Discover more about diseases related to CTRP6 Recombinant Protein (H00114904-P01).
 

Pathways for CTRP6 Recombinant Protein (H00114904-P01)

View related products by pathway.

PTMs for CTRP6 Recombinant Protein (H00114904-P01)

Learn more about PTMs related to CTRP6 Recombinant Protein (H00114904-P01).

Blogs on CTRP6

There are no specific blogs for CTRP6, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTRP6 Antibody
NBP1-77218
IL-21
594-ML-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CTRP6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol C1QTNF6
Entrez