CTR2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

CTR2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC31A2.
  
  

  Source: E. coli

  Amino Acid Sequence: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: SLC31A2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85512.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CTR2 Recombinant Protein Antigen

• Copper transporter 2
• COPT2SLC13A2
• CTR2Solute carrier family 31 member 2
• hCTR2probable low affinity copper uptake protein 2
• solute carrier family 31 (copper transporters), member 2

Background

SLC31A2, also known as CTR2, is a SLC31A transporter family member. Although the function of CTR2 is still poorly understood in mammalian cells, it is expected to be involved in low-affinity copper uptake. It is believed to be confined to lysosomes which stimulate copper delivery to the the cytosol of human cells at high concentrations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

FAQs for CTR2 Protein (NBP1-85512PEP). (Showing 1 - 1 of 1 FAQ).

1. I have searched your website to find ctr2 antibody for my rat experiment(mainly about IHC &WB), however, I found most ctr2 antibody used for mouse and human not for rat.Could you help me to check the information on ctr2 antibody ?Thanks a lot!
   • We have two antibodies to CTR2 - NBP1-05199 which is validated for Western blotting using samples from human and mouse, and NBP1-85512 which is validated for IHC-P using human samples. Human and mouse CTR2 share a 77% sequence homology, however I am unable to align either of these sequence with that of the rat protein, since the rat sequence is not available on UniProt. If you have the rat sequence I would be happy to perform the alignment for you, email technical@novusbio.com. If you wish to try either of these antibodies in an untested species or application I can strongly recommend our Innovators Reward Program. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. This allows us to gain more information on our products, and enables you to save money.

Bioinformatics

• Gene Symbol: SLC31A2