CTR2 Recombinant Protein Antigen

Images

 
There are currently no images for CTR2 Protein (NBP1-85512PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

CTR2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC31A2.

Source: E. coli

Amino Acid Sequence: YEGIKVGKAKLLNQVLVNLPTSISQQTIAETDGDSAGSDSFPVGRTHHRWYLC

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SLC31A2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85512.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for CTR2 Recombinant Protein Antigen

  • Copper transporter 2
  • COPT2SLC13A2
  • CTR2Solute carrier family 31 member 2
  • hCTR2probable low affinity copper uptake protein 2
  • solute carrier family 31 (copper transporters), member 2

Background

SLC31A2, also known as CTR2, is a SLC31A transporter family member. Although the function of CTR2 is still poorly understood in mammalian cells, it is expected to be involved in low-affinity copper uptake. It is believed to be confined to lysosomes which stimulate copper delivery to the the cytosol of human cells at high concentrations.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-402
Species: Ca, Hu, Mu, Po, Rt, Xp, Ze
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB4614
Species: Hu
Applications: CyTOF-ready, Flow, KO
NB100-360
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-59376
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-06611
Species: Hu
Applications: ICC/IF, WB
AF6428
Species: Hu
Applications: IHC, WB
NB120-14817
Species: Hu, Rt
Applications: ICC/IF, IHC, S-ELISA, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB6500
Species: Mu
Applications: CyTOF-ready, Flow, IHC
H00001678-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
H00004489-P01
Species: Hu
Applications: ELISA, AP, PA, WB
202-IL
Species: Hu
Applications: BA
NB100-40840
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-60106
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56490
Species: Ca, Hu, Pm
Applications: IHC,  IHC-P, WB
NB100-91266
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
AF6517
Species: Hu
Applications: WB
AF4875
Species: Hu
Applications: WB

Publications for CTR2 Protein (NBP1-85512PEP) (0)

There are no publications for CTR2 Protein (NBP1-85512PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTR2 Protein (NBP1-85512PEP) (0)

There are no reviews for CTR2 Protein (NBP1-85512PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for CTR2 Protein (NBP1-85512PEP). (Showing 1 - 1 of 1 FAQ).

  1. I have searched your website to find ctr2 antibody for my rat experiment(mainly about IHC &WB), however, I found most ctr2 antibody used for mouse and human not for rat.Could you help me to check the information on ctr2 antibody ?Thanks a lot!
    • We have two antibodies to CTR2 - NBP1-05199 which is validated for Western blotting using samples from human and mouse, and NBP1-85512 which is validated for IHC-P using human samples. Human and mouse CTR2 share a 77% sequence homology, however I am unable to align either of these sequence with that of the rat protein, since the rat sequence is not available on UniProt. If you have the rat sequence I would be happy to perform the alignment for you, email technical@novusbio.com. If you wish to try either of these antibodies in an untested species or application I can strongly recommend our Innovators Reward Program. To participate you simply complete an online review with an image, detailing the positive or negative results of your study, and in return you receive a discount voucher for 100% of the purchase price of the reviewed product. This allows us to gain more information on our products, and enables you to save money.

Additional CTR2 Products

Array NBP1-85512PEP

Research Areas for CTR2 Protein (NBP1-85512PEP)

Find related products by research area.

Blogs on CTR2

There are no specific blogs for CTR2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our CTR2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC31A2