Recombinant Human CTL1/SLC44A1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human CTL1/SLC44A1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 74-183 of Human CDW92 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TKLEAIPNSGMDHTQRKYVFFLDPCNLDLINRKIKSVALCVAACPRQELKTLSDVQKFAEINGSALCSYNLKPSEYTTSPKSSVLCPKLPVPASAPIPFFHRCAPVNISC

Protein/Peptide Type
Partial Recombinant Protein
Gene
SLC44A1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
PBS

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human CTL1/SLC44A1 Protein

  • CD92 antigen
  • CD92
  • CDW92 antigen
  • CDw92
  • CDW92choline transporter-like protein 1
  • CHTL1
  • CTL1
  • CTL1CD92RP11-287A8.1
  • SLC44A1
  • Solute carrier family 44 member 1
  • solute carrier family 44, member 1

Background

SLC44A1 - CDW92 antigen

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB110-74570
Species: Hu, Mu, Rt, Pm
Applications: WB, IHC, IHC-Fr, IHC-P
H00057153-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-76847
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-89417
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-51684
Species: Hu
Applications: WB, ELISA, Flow
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
H00005452-D01P
Species: Hu, Mu, Rt
Applications: WB
NBP1-30052
Species: Hu, Mu, Rt, Av, Ch, GP, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-WhMt
NBP1-80996
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-65338
Species: Hu, Po, Ca, Pm
Applications: Flow, IHC, IHC-Fr, IP
AF1875
Species: Hu
Applications: WB, Flow, Block, CyTOF-ready
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00023446-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01) (0)

There are no publications for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01) (0)

There are no reviews for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional CTL1/SLC44A1 Products

Bioinformatics Tool for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01)

Discover related pathways, diseases and genes to CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01)

Discover more about diseases related to CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01).
 

Pathways for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01)

View related products by pathway.

PTMs for CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01)

Learn more about PTMs related to CTL1/SLC44A1 Partial Recombinant Protein (H00023446-Q01).

Blogs on CTL1/SLC44A1

There are no specific blogs for CTL1/SLC44A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTL1/SLC44A1 Antibody
H00023446-A01

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human CTL1/SLC44A1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC44A1
Entrez